Property Summary

NCBI Gene PubMed Count 40
PubMed Score 1144.55
PubTator Score 178.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
ependymoma 1.200 8.7e-03
osteosarcoma -1.176 2.5e-03
sonic hedgehog group medulloblastoma 1.700 1.5e-08
astrocytoma 1.400 4.7e-04
atypical teratoid / rhabdoid tumor 1.400 2.3e-06
medulloblastoma, large-cell 1.700 6.7e-06
primitive neuroectodermal tumor 1.200 1.6e-04
pancreatic ductal adenocarcinoma liver m... 1.305 5.2e-03
intraductal papillary-mucinous neoplasm ... 1.300 4.4e-03
Hydrolethalus syndrome -1.104 4.9e-02
lung cancer 1.200 1.5e-04
lung adenocarcinoma 1.200 1.3e-12
ovarian cancer 1.400 2.6e-05

 GWAS Trait (1)

Gene RIF (11)

PMID Text
25496916 Small nuclear ribonucleoprotein polypeptide A (SNRPA) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
24362020 a new mechanism for regulating SMN levels and provides new insight into the roles of U1A in 3' processing of mRNAs.
23166591 Small nuclear ribonucleoprotein polypeptide A (SNRPA) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
21419778 An analysis of the kinetic data suggests three phases of U1A-SL2 RNA complex dissociation with time scales of approximately 100 mus, approximately 50 ms, and approximately 2 s. We propose that the first step of dissociation is a fast rearrangement of the complex to form a loosely bound complex.
21384338 structural analysis of U1A protein-stem loop 2 RNA recognition
21298455 study shows that the yellow fever virus (YFV) NS5 protein is able to interact with U1A, a protein involved in splicing and polyadenylation; a region between amino acids 368 and 448 was identified as the site of interaction of the NS5 protein with U1A
18854154 Knockdown of small nuclear ribonucleoprotein polypeptide A (SNRPA) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
17942741 Functional U1A site in a cellular gene and of a single gene containing two dissimilar elements that inhibit nuclear polyadenylation.
17507659 Identification of PSF, p54(nrb), PTB, and U1A as proteins specifically bound to the COX-2 polyadenylation signal upstream sequence elements .
15890361 13)C NMR relaxation studies of base and ribose dynamics for the RNA internal loop target of human U1A protein located within the 3'-untranslated region (3'-UTR) of the mRNA coding for U1A itself
11420046 Small nuclear ribonucleoprotein polypeptide A (SNRPA) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS

AA Sequence

MAVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALR      1 - 70
SMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFVERDRKREKRKPKSQETPATKKAVQGGGATPVVGAVQGP     71 - 140
VPGMPPMTQAPRIMHHMPGQPPYMPPPGMIPPPGLAPGQIPPGAMPPQQLMPGQMPPAQPLSENPPNHIL    141 - 210
FLTNLPEETNELMLSMLFNQFPGFKEVRLVPGRHDIAFVEFDNEVQAGAARDALQGFKITQNNAMKISFA    211 - 280
KK                                                                        281 - 282
//

Text Mined References (48)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
24362020 2014 U1A regulates 3' processing of the survival motor neuron mRNA.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21419778 2011 Multistep kinetics of the U1A-SL2 RNA complex dissociation.
21384338 2011 U1A protein-stem loop 2 RNA recognition: prediction of structural differences from protein mutations.
21298455 2011 The small nuclear ribonucleoprotein U1A interacts with NS5 from yellow fever virus.
21269460 2011 Initial characterization of the human central proteome.
21113136 2010 Functional organization of the Sm core in the crystal structure of human U1 snRNP.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19561594 2009 Rapid and systematic analysis of the RNA recognition specificities of RNA-binding proteins.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17942741 2007 A bipartite U1 site represses U1A expression by synergizing with PIE to inhibit nuclear polyadenylation.
17507659 2007 Specific trans-acting proteins interact with auxiliary RNA polyadenylation elements in the COX-2 3'-UTR.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15890361 2005 13C NMR relaxation studies of RNA base and ribose nuclei reveal a complex pattern of motions in the RNA binding site for human U1A protein.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
11101529 2000 Functional analysis of the human CDC5L complex and identification of its components by mass spectrometry.
10742179 2000 The NMR structure of the 38 kDa U1A protein - PIE RNA complex reveals the basis of cooperativity in regulation of polyadenylation by human U1A protein.
10688667 2000 Fourteen residues of the U1 snRNP-specific U1A protein are required for homodimerization, cooperative RNA binding, and inhibition of polyadenylation.
10648562 2000 An ATP-dependent, Ran-independent mechanism for nuclear import of the U1A and U2B" spliceosome proteins.
9848648 1998 The snRNP-free U1A (SF-A) complex(es): identification of the largest subunit as PSF, the polypyrimidine-tract binding protein-associated splicing factor.
9731529 1998 Mass spectrometry and EST-database searching allows characterization of the multi-protein spliceosome complex.
9312034 1997 Structural basis of the RNA-binding specificity of human U1A protein.
9265619 1997 Tertiary structure of RBD2 and backbone dynamics of RBD1 and RBD2 of the human U1A protein determined by NMR spectroscopy.
8609632 1996 Solution structure of the N-terminal RNP domain of U1A protein: the role of C-terminal residues in structure stability and RNA binding.
8602269 1996 Specificity of ribonucleoprotein interaction determined by RNA folding during complex formulation.
8070414 1994 NMR studies of U1 snRNA recognition by the N-terminal RNP domain of the human U1A protein.
7984237 1994 Crystal structure at 1.92 A resolution of the RNA-binding domain of the U1A spliceosomal protein complexed with an RNA hairpin.
2962859 1987 cDNA cloning of the human U1 snRNA-associated A protein: extensive homology between U1 and U2 snRNP-specific proteins.
2147232 1990 Crystal structure of the RNA-binding domain of the U1 small nuclear ribonucleoprotein A.
1833186 1991 Identification of molecular contacts between the U1 A small nuclear ribonucleoprotein and U1 RNA.
1831431 1991 Structure, chromosomal localization and evolutionary conservation of the gene encoding human U1 snRNP-specific A protein.
1826055 1991 RNA-binding domain of the A protein component of the U1 small nuclear ribonucleoprotein analyzed by NMR spectroscopy is structurally similar to ribosomal proteins.
1701111 1990 Assignment of seven genes to distinct intervals on the midportion of human chromosome 19q surrounding the myotonic dystrophy gene region.
1696729 1990 Quantitative determination that one of two potential RNA-binding domains of the A protein component of the U1 small nuclear ribonucleoprotein complex binds with high affinity to stem-loop II of U1 RNA.