Property Summary

NCBI Gene PubMed Count 43
PubMed Score 1171.25
PubTator Score 178.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytoma 1.400 4.7e-04
atypical teratoid / rhabdoid tumor 1.400 2.3e-06
ependymoma 1.200 8.7e-03
group 3 medulloblastoma 1.300 9.7e-05
Hydrolethalus syndrome -1.104 4.9e-02
intraductal papillary-mucinous neoplasm ... 1.300 4.4e-03
lung adenocarcinoma 1.200 1.3e-12
lung cancer 1.200 1.5e-04
medulloblastoma, large-cell 1.700 6.7e-06
osteosarcoma -1.176 2.5e-03
ovarian cancer 1.400 2.6e-05
pancreatic ductal adenocarcinoma liver m... 1.305 5.2e-03
primitive neuroectodermal tumor 1.200 1.6e-04

PDB (68)

Gene RIF (12)

AA Sequence

MAVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALR      1 - 70
SMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFVERDRKREKRKPKSQETPATKKAVQGGGATPVVGAVQGP     71 - 140
VPGMPPMTQAPRIMHHMPGQPPYMPPPGMIPPPGLAPGQIPPGAMPPQQLMPGQMPPAQPLSENPPNHIL    141 - 210
FLTNLPEETNELMLSMLFNQFPGFKEVRLVPGRHDIAFVEFDNEVQAGAARDALQGFKITQNNAMKISFA    211 - 280
KK                                                                        281 - 282
//

Text Mined References (51)

PMID Year Title