Property Summary

NCBI Gene PubMed Count 80
PubMed Score 426.45
PubTator Score 347.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytoma 1.400 3.3e-02
ependymoma 1.300 2.4e-02
psoriasis -1.800 9.7e-04
osteosarcoma 1.070 4.6e-04
pancreatic ductal adenocarcinoma liver m... 1.729 9.3e-04
spina bifida 1.312 4.6e-02
Pick disease -1.600 4.1e-05
progressive supranuclear palsy -1.100 4.8e-03
ovarian cancer 1.900 1.0e-07

Protein-protein Interaction (172)

U2SURP   DHX15   SART1   HNRNPR   PRPF3   PPIH   PLRG1   NUDT21   DHX16   AQR   CDC40   PQBP1   PRPF40A   WBP4   BCAS2   SMNDC1   PCF11   CD2BP2   CPSF4   LSM8   HNRNPC   SNRPB2   SNRPA   HNRNPA1   SNRPA1   HNRNPL   HNRNPA2B1   U2AF2   PTBP1   HNRNPH1   CSTF2   RBMX   PAPOLA   HNRNPA3   HNRNPM   HNRNPF   HNRNPH2   HNRNPK   LSM3   LSM6   SNURF   SRSF3   HNRNPU   U2AF1   SRSF2   CSTF1   SRSF1   SRSF4   CPSF1   SF3A3   CSTF3   HNRNPA0   SRSF9   SRSF5   SRSF6   SF3B2   HNRNPD   RNPS1   PCBP1   PCBP2   SF3B3   SF3B4   SF3A2   SF3A1   SF1   USP39   PRPF8   FIP1L1   CWC27   DDX46   PABPN1   ALYREF   DDX42   CHERP   SUGP1   CCAR1   SRRM1   CPSF7   PRPF38A   U2AF1L4   SNRNP27   PRPF31   DHX38   CLP1   SNRNP40   RBM17   CDC5L   HNRNPUL1   SF3B5   CRNKL1   CSTF2T   CWC22   RBM22   CWC25   CWC15   CPSF2   PUF60   LSM7   CPSF3   ISY1   PRPF19   SRRM2   WBP11   LSM5   LSM4   SNRPC   NOP10   LARP7   RPL26   GEMIN7   CCDC137   KNOP1   PRRC2C   POP1   MRPS9   BCLAF1   THRAP3   SRPK2   PTCD3   DKC1   UPF1   PABPC1   RBMXL1   CMTR2   GEMIN4   NCBP1   SCAF1   PINX1   HIST1H2AG   PRRC2A   MRPS10   DAP3   GTPBP1   LARP1   LARP1B   PHAX   MRPS31   GEMIN5   MRPS22   MRPL45   MRPS35   SNRPD2   MRPS26   ZC3H14   MRPS7   MEPCE   TGS1   YTHDC1   RALY   MRPS14   SNRPD3   FOXP1   SMN2   MRPS33   RPP40   KLHL8   WDR33   SNRPD1   SNRPB   MRPL15   MKRN1   SPOUT1   TRA2B   SCAF11   TOE1   SRSF8   SLTM   MRPS18C   SRSF12   SRSF10   CLK2   MKRN2  

Gene RIF (28)

PMID Text
26828962 The authors propose that Gemin2 is a versatile hub for ribonucleoprotein exchange that functions broadly in RNA metabolism.
26333287 The epitopes of U1-70K autoantibodies have been mapped at single-amino acid resolution.
26124092 data lead to a model that FUS functions in coupling transcription to splicing via mediating an interaction between RNAP II and U1 snRNP
25795785 methylation of snRNP70 by SETMAR regulates constitutive and/or alternative splicing
25555158 The selection of 5'-splice site nucleotides by U1 snRNP is achieved predominantly through basepairing with U1 snRNA whilst U1-C fine-tunes relative affinities of mismatched 5'-splice sites.
25355317 Data indicate that small nuclear ribonucleoprotein U1-70K in Alzheimer disease (AD) may directly sequester normal soluble forms of U1-70K into insoluble aggregates.
25052091 U1-70K interacts with the SMN complex and is required for nuclear gem integrity.
24773620 These studies identify U1 snRNP pathologic changes in brain of early onset genetic forms of Alzheimer's disease
24461387 [review] The presence of antibodies against U1snRNP autoantigen is considered the serological hallmark of mixed connective tissue disease (MCTD), which is characterized by overlapping features between at least two systemic autoimmune diseases.
24023061 Our results demonstrate unique U1 snRNP pathology and implicate abnormal RNA splicing in Alzheimer's disease pathogenesis.
24023061 High expression of U1-70K and other U1 small nuclear ribonucleoproteins spliceosome proteins in Alzheimer's disease patients and those with mild cognitive impairment.
23874216 inhibition of U1 snRNP also leads to regulation of the usage of In3 pA, suggesting that the C/P activity in the cell can be cross-regulated by splicing, leading to coordination between these two processes.
22490866 U1-snRNP activates the NOD-like receptor family, pyrin domain-containing 3 (NLRP3) inflammasome in CD14+ human monocytes dependently of anti-U1-snRNP Abs, leading to interleukin (IL)-1beta production.
22454191 Serum antibodies against the 70k polypeptides of the U1 ribonucleoprotein complex are associated with psychiatric syndromes in systemic lupus erythematosus.
22174317 HIV-1 Rev interacting protein, small nuclear ribonucleoprotein 70kDa (SNRNP70), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with SNRNP70 is increased by RRE
21536904 the hypo-phosphorylated RS domain of SRSF1 interacts with its own RRM, thus competing with U1-70K binding, whereas the hyper-phosphorylated RS domain permits the formation of a ternary complex containing ESE, an SR protein, and U1 snRNP
21348812 data identify some fungal proteins as possible triggers of anti-U1-70 kDa autoimmunity via molecular mimicry.
20519584 Recruitment of RNAPII, U1-70K and ASF/SF2 protein to transcription sites is splicing independent.
20500824 crucial association of B19-NS1 in development of autoimmunity by inducing apoptosis and specific cleavage of 70 kDa U1-snRNP
19784376 U1-70k isoforms control subunit dynamics in the human spliceosomal U1 snRNP
19419839 The novel association of anti-thyroid antibodies with anti-U1RNP antibodies in juvenile onset Systemic Lupus Erythematosus seems to identify a subgroup of patients with less life-threatening organ involvement.
19232124 Our findings suggest a potential role of CMV in regulation of autoantibodies to snRNPs
18523312 In a transgenic model of mixed connective tissue disease, T cell recognition of the U1 70-kDa autoantigen by HLA-DR4-transgenic mice is focused on a limited number of T cell epitopes residing primarily within the RNA-binding domain of the RNP autoantigen.
18202700 Examine changes in phosphorylation/dephosphorylation balance and the subcellular localization of the U1-70K protein during apoptosis.
17622584 Specific binding of heterogenous nuclear ribonucleoprotein E1 (hnRNP E1) and U1 small nuclear ribonucleoprotein (snRNP) in the pre-spliceosomal complex was associated with silencing of pseudoexon splicing.
14688384 Apoptotic modification and the presence of an RNA binding domain may both contribute to autoantigenicity of the lupus U1-70-kDa ribonucleoprotein.
12218166 A remarkably limited and consistent pattern of T cell targeting of U1-70kDa in connective tissue disease patients is observed in T cell clones generated against U1-70kDa: all clones are specific for epitopes within the RNA binding domain of the protein.
12115232 Apoptotic U1-70 kd is antigenically distinct from the intact form of the U1-70-kd molecule.

AA Sequence

MTQFLPPNLLALFAPRDPIPYLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRAETREERMERK      1 - 70
RREKIERRQQEVETELKMWDPHNDPNAQGDAFKTLFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRS     71 - 140
GKPRGYAFIEYEHERDMHSAYKHADGKKIDGRRVLVDVERGRTVKGWRPRRLGGGLGGTRRGGADVNIRH    141 - 210
SGRDDTSRYDERPGPSPLPHRDRDRDRERERRERSRERDKERERRRSRSRDRRRRSRSRDKEERRRSRER    211 - 280
SKDKDRDRKRRSSRSRERARRERERKEELRGGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEEKGRDR    281 - 350
DRERRRSHRSERERRRDRDRDRDRDREHKRGERGSERGRDEARGGGGGQDNGLEGLGNDSRDMYMESEGG    351 - 420
DGYLAPENGYLMEAAPE                                                         421 - 437
//

Text Mined References (95)

PMID Year Title
26828962 2016 A U1 snRNP-specific assembly pathway reveals the SMN complex as a versatile hub for RNP exchange.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26333287 2015 Mapping epitopes of U1-70K autoantibodies at single-amino acid resolution.
26124092 2015 FUS functions in coupling transcription to splicing by mediating an interaction between RNAP II and U1 snRNP.
25795785 2015 A Proteomic Strategy Identifies Lysine Methylation of Splicing Factor snRNP70 by the SETMAR Enzyme.
25719862 2015 Modulation of deregulated chaperone-mediated autophagy by a phosphopeptide.
25555158 2015 Crystal structure of human U1 snRNP, a small nuclear ribonucleoprotein particle, reveals the mechanism of 5' splice site recognition.
25355317 2014 Aggregation properties of the small nuclear ribonucleoprotein U1-70K in Alzheimer disease.
25052091 2014 The splicing factor U1-70K interacts with the SMN complex and is required for nuclear gem integrity.
24773620 2014 U1 small nuclear ribonucleoproteins (snRNPs) aggregate in Alzheimer's disease due to autosomal dominant genetic mutations and trisomy 21.
24461387 The diagnosis and classification of mixed connective tissue disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24023061 2013 U1 small nuclear ribonucleoprotein complex and RNA splicing alterations in Alzheimer's disease.
23874216 2013 The conserved intronic cleavage and polyadenylation site of CstF-77 gene imparts control of 3' end processing activity through feedback autoregulation and by U1 snRNP.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22490866 2012 U1-small nuclear ribonucleoprotein activates the NLRP3 inflammasome in human monocytes.
22454191 2013 Serum antibodies against the 70k polypeptides of the U1 ribonucleoprotein complex are associated with psychiatric syndromes in systemic lupus erythematosus: a retrospective study.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21536904 2011 Interaction between the RNA binding domains of Ser-Arg splicing factor 1 and U1-70K snRNP protein determines early spliceosome assembly.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21348812 2011 Potential role of molecular mimicry between human U1-70 kDa and fungal proteins in the development of T-cell mediated anti-U1-70 kDa autoimmunity.
21269460 2011 Initial characterization of the human central proteome.
21113136 2010 Functional organization of the Sm core in the crystal structure of human U1 snRNP.
20519584 2010 Splicing-independent recruitment of U1 snRNP to a transcription unit in living cells.
20500824 2010 Human parvovirus B19 nonstructural protein NS1 enhanced the expression of cleavage of 70 kDa U1-snRNP autoantigen.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19784376 2009 Isoforms of U1-70k control subunit dynamics in the human spliceosomal U1 snRNP.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19419839 2009 Juvenile onset Systemic Lupus Erythematosus thyroid dysfunction: a subgroup with mild disease?
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19325628 2009 Crystal structure of human spliceosomal U1 snRNP at 5.5 A resolution.
19232124 2009 Reduced IgG anti-small nuclear ribonucleoprotein autoantibody production in systemic lupus erythematosus patients with positive IgM anti-cytomegalovirus antibodies.
18951082 2008 Death by splicing: tumor suppressor RBM5 freezes splice-site pairing.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18559850 2008 Minor spliceosome components are predominantly localized in the nucleus.
18523312 2008 CD4+ T cells target epitopes residing within the RNA-binding domain of the U1-70-kDa small nuclear ribonucleoprotein autoantigen and have restricted TCR diversity in an HLA-DR4-transgenic murine model of mixed connective tissue disease.
18202700 2008 Apoptosis-linked changes in the phosphorylation status and subcellular localization of the spliceosomal autoantigen U1-70K.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17622584 2007 Pre-spliceosomal binding of U1 small nuclear ribonucleoprotein (RNP) and heterogenous nuclear RNP E1 is associated with suppression of a growth hormone receptor pseudoexon.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
14765198 2004 Dephosphorylated SRp38 acts as a splicing repressor in response to heat shock.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14688384 2004 A major B cell epitope present on the apoptotic but not the intact form of the U1-70-kDa ribonucleoprotein autoantigen.
14561889 2003 Association of polyadenylation cleavage factor I with U1 snRNP.
12560496 2003 The FCP1 phosphatase interacts with RNA polymerase II and with MEP50 a component of the methylosome complex involved in the assembly of snRNP.
12548559 2003 T cell recognition and therapeutic effect of a phosphorylated synthetic peptide of the 70K snRNP protein administered in MR/lpr mice.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12456665 2002 A novel function for human factor C1 (HCF-1), a host protein required for herpes simplex virus infection, in pre-mRNA splicing.
12417631 2002 Human autoimmune sera as molecular probes for the identification of an autoantigen kinase signaling pathway.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
12218166 2002 T cell immunity in connective tissue disease patients targets the RNA binding domain of the U1-70kDa small nuclear ribonucleoprotein.
12193588 2002 RH70, a bidirectional RNA helicase, co-purifies with U1snRNP.
11780068 2001 Stimulatory effect of splicing factors on transcriptional elongation.
11748230 2002 Purification of native survival of motor neurons complexes and identification of Gemin6 as a novel component.
11741604 2001 RNA ligands generated against complex nuclear targets indicate a role for U1 snRNP in co-ordinating transcription and RNA splicing.
11514619 2001 Nuclear relocalization of the pre-mRNA splicing factor PSF during apoptosis involves hyperphosphorylation, masking of antigenic epitopes, and changes in protein interactions.
11500380 2001 A novel U2 and U11/U12 snRNP protein that associates with the pre-mRNA branch site.
11448987 2001 ZNF265--a novel spliceosomal protein able to induce alternative splicing.
10725331 2000 Gemin4. A novel component of the SMN complex that is found in both gems and nucleoli.
10339552 1999 The SRm160/300 splicing coactivator is required for exon-enhancer function.
9826776 1998 At least three linear regions but not the zinc-finger domain of U1C protein are exposed at the surface of the protein in solution and on the human spliceosomal U1 snRNP particle.
9799243 1998 Phosphorylation-dephosphorylation differentially affects activities of splicing factor ASF/SF2.
9731529 1998 Mass spectrometry and EST-database searching allows characterization of the multi-protein spliceosome complex.
9685421 1998 A serine/arginine-rich domain in the human U1 70k protein is necessary and sufficient for ASF/SF2 binding.
9531537 1998 A coactivator of pre-mRNA splicing.
9447963 1998 Sip1, a novel RS domain-containing protein essential for pre-mRNA splicing.
9281376 1997 Nuclear accumulation of the U1 snRNP-specific protein C is due to diffusion and retention in the nucleus.
9016565 1997 Association of U2 snRNP with the spliceosomal complex E.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8816452 1996 Functional properties of p54, a novel SR protein active in constitutive and alternative splicing.
8746626 1995 Identification of an inhibitory element within the human 68-kDa (U1) ribonucleoprotein antigen.
8332490 1993 Identification of an snRNP-associated kinase activity that phosphorylates arginine/serine rich domains typical of splicing factors.
8261509 1993 Specific interactions between proteins implicated in splice site selection and regulated alternative splicing.
7516470 1994 The U1 small nuclear ribonucleoprotein (snRNP) 70K protein is transported independently of U1 snRNP particles via a nuclear localization signal in the RNA-binding domain.
3028775 1986 Cloning of the human cDNA for the U1 RNA-associated 70K protein.
2477447 1989 C-reactive protein reacts with the U1 small nuclear ribonucleoprotein.
2467746 1989 A common RNA recognition motif identified within a defined U1 RNA binding domain of the 70K U1 snRNP protein.
2447561 1987 The human U1-70K snRNP protein: cDNA cloning, chromosomal localization, expression, alternative splicing and RNA-binding.
2147422 1990 Human U1-70K ribonucleoprotein antigen gene: organization, nucleotide sequence, and mapping to locus 19q13.3.
1833625 1991 U1 SnRNP association with HnRNP involves an initial non-specific splice-site independent interaction of U1 SnRNP protein with HnRNA.