Property Summary

NCBI Gene PubMed Count 17
PubMed Score 441.71
PubTator Score 125.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
group 3 medulloblastoma 1.800 2.4e-05
lung cancer 1.200 3.8e-02
malignant mesothelioma 1.300 7.2e-07
medulloblastoma, large-cell 1.100 4.8e-04
pituitary cancer 1.100 6.9e-05
primitive neuroectodermal tumor 1.100 1.2e-03
subependymal giant cell astrocytoma -1.099 3.7e-02

 GO Function (1)

Gene RIF (2)

AA Sequence

MIEQQKRKGPELPLVPVKRQRHELLLGAGSGPGAGQQQATPGALLQAGPPRCSSLQAPIMLLSGHEGEVY      1 - 70
CCKFHPNGSTLASAGFDRLILLWNVYGDCDNYATLKGHSGAVMELHYNTDGSMLFSASTDKTVAVWDSET     71 - 140
GERVKRLKGHTSFVNSCYPARRGPQLVCTGSDDGTVKLWDIRKKAAIQTFQNTYQVLAVTFNDTSDQIIS    141 - 210
GGIDNDIKVWDLRQNKLTYTMRGHADSVTGLSLSSEGSYLLSNAMDNTVRVWDVRPFAPKERCVKIFQGN    211 - 280
VHNFEKNLLRCSWSPDGSKIAAGSADRFVYVWDTTSRRILYKLPGHAGSINEVAFHPDEPIIISASSDKR    281 - 350
LYMGEIQ                                                                   351 - 357
//

Text Mined References (22)

PMID Year Title