Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.74
PubTator Score 0.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma -1.073 3.8e-03
adult high grade glioma -1.400 2.7e-04
astrocytoma -1.200 1.8e-02
Astrocytoma, Pilocytic -1.200 1.6e-06
Breast cancer 1.200 6.8e-14
group 4 medulloblastoma -1.300 3.6e-05
invasive ductal carcinoma 1.100 1.0e-02
lung cancer 1.400 1.2e-02
medulloblastoma, large-cell -1.300 5.4e-05
ovarian cancer 1.800 7.6e-05

Gene RIF (1)

AA Sequence

MDVFQEGLAMVVQDPLLCDLPIQVTLEEVNSQIALEYGQAMTVRVCKMDGEVMPVVVVQSATVLDLKKAI      1 - 70
QRYVQLKQEREGGIQHISWSYVWRTYHLTSAGEKLTEDRKKLRDYGIRNRDEVSFIKKLRQK             71 - 132
//

Text Mined References (9)

PMID Year Title