Property Summary

NCBI Gene PubMed Count 10
PubMed Score 54.21
PubTator Score 24.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma -1.800 1.0e-06
ependymoma -1.900 5.5e-13
astrocytoma -1.100 3.5e-19
glioblastoma -2.400 1.8e-05
oligodendroglioma -1.200 4.3e-16
osteosarcoma 1.006 5.0e-03
medulloblastoma -2.800 1.7e-09
atypical teratoid / rhabdoid tumor -2.900 8.8e-11
medulloblastoma, large-cell -3.200 1.2e-05
primitive neuroectodermal tumor -2.300 2.3e-05
adult high grade glioma -2.400 1.2e-06

 GO Function (1)

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
12896979 syntaphilin is an inhibitor of both SNARE-based fusion and dynamin-mediated endocytosis

AA Sequence

MAMSLPGSRRTSAGSRRRTSPPVSVRDAYGTSSLSSSSNSGSYKGSDSSPTPRRSMKYTLCSDNHGIKPP      1 - 70
TPEQYLTPLQQKEVCIRHLKARLKDTQDRLQDRDTEIDDLKTQLSRMQEDWIEEECHRVEAQLALKEARK     71 - 140
EIKQLKQVIDTVKNNLIDKDKGLQKYFVDINIQNKKLETLLHSMEVAQNGMAKEDGTGESAGGSPARSLT    141 - 210
RSSTYTKLSDPAVCGDRQPGDPSSGSAEDGADSGFAAADDTLSRTDALEASSLLSSGVDCGTEETSLHSS    211 - 280
FGLGPRFPASNTYEKLLCGMEAGVQASCMQERAIQTDFVQYQPDLDTILEKVTQAQVCGTDPESGDRCPE    281 - 350
LDAHPSGPRDPNSAVVVTVGDELEAPEPITRGPTPQRPGANPNPGQSVSVVCPMEEEEEAAVAEKEPKSY    351 - 420
WSRHYIVDLLAVVVPAVPTVAWLCRSQRRQGQPIYNISSLLRGCCTVALHSIRRISCRSLSQPSPSPAGG    421 - 490
GSQL                                                                      491 - 494
//

Text Mined References (11)

PMID Year Title
24483146 2014 Discovery of genetic biomarkers contributing to variation in drug response of cytidine analogues using human lymphoblastoid cell lines.
23264731 2013 MTR120/KIAA1383, a novel microtubule-associated protein, promotes microtubule stability and ensures cytokinesis.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15459722 2004 Syntabulin is a microtubule-associated protein implicated in syntaxin transport in neurons.
12896979 2003 Syntaphilin binds to dynamin-1 and inhibits dynamin-dependent endocytosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
10707983 2000 Syntaphilin: a syntaxin-1 clamp that controls SNARE assembly.
9205841 1997 Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.