Property Summary

NCBI Gene PubMed Count 12
PubMed Score 190.74
PubTator Score 16.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 1.200 1.3e-06
atypical teratoid / rhabdoid tumor -1.700 2.2e-06
medulloblastoma, large-cell -1.900 8.2e-05
primitive neuroectodermal tumor -1.300 2.3e-04
lung cancer -1.300 1.1e-03
adult high grade glioma -1.200 1.2e-02
Pick disease -1.300 2.8e-05
ulcerative colitis 1.700 1.3e-06

AA Sequence

MSIMDHSPTTGVVTVIVILIAIAALGALILGCWCYLRLQRISQSEDEESIVGDGETKEPFLLVQYSAKGP      1 - 70
CVERKAKLMTPNGPEVHG                                                         71 - 88
//

Text Mined References (16)

PMID Year Title
27015288 2016 Hemotin, a Regulator of Phagocytosis Encoded by a Small ORF and Conserved across Metazoans.
19305408 2009 Common variants at ten loci influence QT interval duration in the QTGEN Study.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16381901 2006 The LIFEdb database in 2006.
16246365 2005 Structure, dynamics, and membrane topology of stannin: a mediator of neuronal cell apoptosis induced by trimethyltin chloride.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
15269288 2004 Stannin, a protein that localizes to the mitochondria and sensitizes NIH-3T3 cells to trimethyltin and dimethyltin toxicity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10233894 1999 Vascular endothelial genes that are responsive to tumor necrosis factor-alpha in vitro are expressed in atherosclerotic lesions, including inhibitor of apoptosis protein-1, stannin, and two novel genes.
9657854 1998 Chromosomal localization and characterization of the stannin (Snn) gene.
9413842 1997 Localization and characterization of stannin: relationship to cellular sensitivity to organotin compounds.
1635553 1992 Molecular neurotoxicology of trimethyltin: identification of stannin, a novel protein expressed in trimethyltin-sensitive cells.