1. Home
  2. Targets
  3. Smad nuclear-interacting protein 1

Tbio Smad nuclear-interacting protein 1

Down-regulates NF-kappa-B signaling by competing with RELA for CREBBP/EP300 binding. Involved in the microRNA (miRNA) biogenesis. May be involved in cyclin-D1/CCND1 mRNA stability through the SNARP complex which associates with both the 3'end of the CCND1 gene and its mRNA.

This gene encodes a protein that contains a coiled-coil motif and C-terminal forkhead-associated (FHA) domain. The encoded protein functions as a transcriptional coactivator that increases c-Myc activity and inhibits transforming growth factor beta (TGF-beta) and nuclear factor kappa-B (NF-kB) signaling. The encoded protein also regulates the stability of cyclin D1 mRNA, and may play a role in cell proliferation and cancer progression. Mutations in this gene are a cause of psychomotor retardation, epilepsy, and craniofacial dysmorphism (PMRED). [provided by RefSeq, Mar 2012]

 Comments

Property Summary

NCBI Gene PubMed Count 27
PubMed Score 16.25
PubTator Score 13.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7933 7.0e-07
tuberculosis and treatment for 6 months 686 1.1e-04
psoriasis 6685 1.5e-04
oligodendroglioma 2849 8.9e-03
Disease Target Count Z-score Confidence
Epilepsy 346 0.0 4.0

Expression

  Differential Expression (4)

Disease log2 FC p
oligodendroglioma -1.300 8.9e-03
psoriasis -1.200 1.5e-04
osteosarcoma -1.677 7.0e-07
tuberculosis and treatment for 6 months 1.600 1.1e-04

Synonym

Accession Q8TAD8 Q96SP9 Q9H9T7
Symbols PMRED

Gene

SNIP1

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 UniProt Keyword (10)

 GO Function (1)

 GO Component (2)

 GO Process (4)

 Compartment GO Term (20)

See all...

 IMPC Phenotype (3)

 MGI Phenotype (3)

 HCA RNA Cell Line (56)

See all...

Pathway (4)

Protein-protein Interaction (42)

CDK3   BCLAF1   THRAP3   ACIN1   NCBP3   SRRM2   RPL5   ZC3H14   PNN   GPATCH8   NCBP1   CRNKL1   RBM22   AQR   GPALPP1   PPIG   SRSF9   SRSF1   RNPS1   CLASRP   SNW1   PAIP2B   CCDC9   CCDC12   CDC40   ISY1   EIF4A3   CLK3   CASC3   YTHDC1   RALY   PPIE   NKTR   MKRN1   TRA2A   TRA2B   SRSF8   BUD31   SRSF12   SRSF10   DHX8   CLK2  

Gene RIF (9)

PMID Text
23932364 Involvement of SNIP1 in progression of lung cancer by regulating the RB/HDAC1 interaction.
22279524 Study identified sequence variants in the known disease-causing genes SLC6A3 and FLVCR1, and present evidence to strongly support the pathogenicity of variants identified in TUBGCP6, BRAT1, SNIP1, CRADD, and HARS.
22020748 SNIP1 in cells strongly activated the heat shock element signaling pathway, and SNIP1 might selectively regulate the transcription of some heat shock proteins through associating with heat shock elements
21167768 overexpression of HIF-1alpha, TWIST2 or SNIP1 correlated with poor disease-free survival in patients with tongue squamous cell carcinoma
18794151 Study shows a novel mechanism regulating Cyclin D1 expression and offers new insight into the role of SNIP1 and associated proteins as regulators of proliferation and cancer.
18632581 SNIP1, the human homolog of DDL, is involved in miRNA biogenesis and interacts with Drosha
17157259 SNIP1 functions as a regulator of c-Myc activity, binding the N c-Myc N terminus through its C terminus, and that SNIP1 enhances the transcriptional activity of c-Myc by stabilizing it against proteosomal degradation and bridging the c-Myc/p300 complex.
15750622 Smad-binding peptide aptamers can be developed to selectively inhibit TGF-beta-induced gene expression.
15378006 define both a new function for SNIP1 and identify a previously unrecognized regulator of the cell cycle and cyclin D1 expression

AA Sequence 

MKAVKSERERGSRRRHRDGDVVLPAGVVVKQERLSPEVAPPAHRRPDHSGGSPSPPTSEPARSGHRGNRA      1 - 70
RGVSRSPPKKKNKASGRRSKSPRSKRNRSPHHSTVKVKQEREDHPRRGREDRQHREPSEQEHRRARNSDR     71 - 140
DRHRGHSHQRRTSNERPGSGQGQGRDRDTQNLQAQEEEREFYNARRREHRQRNDVGGGGSESQELVPRPG    141 - 210
GNNKEKEVPAKEKPSFELSGALLEDTNTFRGVVIKYSEPPEARIPKKRWRLYPFKNDEVLPVMYIHRQSA    211 - 280
YLLGRHRRIADIPIDHPSCSKQHAVFQYRLVEYTRADGTVGRRVKPYIIDLGSGNGTFLNNKRIEPQRYY    281 - 350
ELKEKDVLKFGFSSREYVLLHESSDTSEIDRKDDEDEEEEEEVSDS                            351 - 396
//

Text Mined References (39)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
24144296 2013 Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error.
23932364 2013 High expression of SNIP1 correlates with poor prognosis in non-small cell lung cancer and SNIP1 interferes with the recruitment of HDAC1 to RB in vitro.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
22279524 2012 Genetic mapping and exome sequencing identify variants associated with five novel diseases.
22020748 2012 SNIP1: a new activator of HSE signaling pathway.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21167768 2011 Hypoxia-inducible factor-1 alpha, in association with TWIST2 and SNIP1, is a critical prognostic factor in patients with tongue squamous cell carcinoma.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18794151 2008 Regulation of cyclin D1 RNA stability by SNIP1.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18632581 2008 The FHA domain proteins DAWDLE in Arabidopsis and SNIP1 in humans act in small RNA biogenesis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17157259 2006 SNIP1 is a candidate modifier of the transcriptional activity of c-Myc on E box-dependent target genes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16371476 2006 PDSM, a motif for phosphorylation-dependent SUMO modification.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15750622 2005 Selective inhibition of TGF-beta responsive genes by Smad-interacting peptide aptamers from FoxH1, Lef1 and CBP.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15378006 2004 The FHA domain protein SNIP1 is a regulator of the cell cycle and cyclin D1 expression.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12097147 2002 A novel link between the proteasome pathway and the signal transduction pathway of the bone morphogenetic proteins (BMPs).
11567019 2001 SNIP1 inhibits NF-kappa B signaling by competing for its binding to the C/H1 domain of CBP/p300 transcriptional co-activators.
10887155 2000 A novel smad nuclear interacting protein, SNIP1, suppresses p300-dependent TGF-beta signal transduction.