Property Summary

NCBI Gene PubMed Count 35
PubMed Score 24.45
PubTator Score 16.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung cancer 4473 2.0e-03
ovarian cancer 8491 2.8e-03

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer 1.100 2.0e-03
ovarian cancer 1.200 2.8e-03

Protein-protein Interaction (12)

Gene RIF (9)

PMID Text
26268989 Knockdown of SNF8 (ESCRT-II component) decreases extracellular HIV-1 CA-p24 levels when using VSV-pseudotyped virus
26268989 shRNA knockdown of SNF8 (ESCRT-II component) impairs intracellular and extracellular (supernatant) HIV-1 CA-p24 production when using VSV-pseudotyped virus; replication is enhanced by SNF8
25232011 Taken together, these data suggest an active role for ESCRT-II and CHMP6 in ESCRT-mediated abscission
23305486 Knockdown of SNF8 (ESCRT-II component) decreases extracellular HIV-1 CA-p24 levels when using VSV-pseudotyped virus
23171048 Modulating SNF8 expression levels alters the TRPC6 channel current and can modulate activation of NFAT-mediated transcription downstream of gain-of-function mutant TRPC6.
22978549 Knockdown of SNF8 (ESCRT-II component) decreases extracellular HIV-1 CA-p24 levels when using VSV-pseudotyped virus
17714434 Vps22 has an important role in ligand-induced EGFR and CXCR4 turnover; termination of EGF signaling occurs prior to ESCRT-II engagement
16973552 there are probably multiple pathways for protein sorting/multivesicular body vesicle formation in human cells and that human immunodeficiency virus type 1 does not utilize an ESCRT-II-dependent pathway to leave the cell
16371348 mammalian ESCRTII is made up of hVps25p, hVps22p, and hVps36p and may be redundant, cargo-specific, or not required for protein sorting at the multivesicular body

AA Sequence

MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEIRKNPEFRVQFQD      1 - 70
MCATIGVDPLASGKGFWSEMLGVGDFYYELGVQIIEVCLALKHRNGGLITLEELHQQVLKGRGKFAQDVS     71 - 140
QDDLIRAIKKLKALGTGFGIIPVGGTYLIQSVPAELNMDHTVVLQLAEKNGYVTVSEIKASLKWETERAR    141 - 210
QVLEHLLKEGLAWLDLQAPGEAHYWLPALFTDLYSQEITAEEAREALP                          211 - 258
//

Text Mined References (38)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25232011 2014 Inhibition of ESCRT-II-CHMP6 interactions impedes cytokinetic abscission and leads to cell death.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23667179 2013 Identification of CAD candidate genes in GWAS loci and their expression in vascular cells.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23171048 2012 SNF8, a member of the ESCRT-II complex, interacts with TRPC6 and enhances its channel activity.
22978549 2012 ESCRT-II's involvement in HIV-1 genomic RNA trafficking and assembly.
22660413 2012 Syndecan-syntenin-ALIX regulates the biogenesis of exosomes.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21378990 2011 Large-scale association analysis identifies 13 new susceptibility loci for coronary artery disease.
21269460 2011 Initial characterization of the human central proteome.
21118109 2010 The role of ESCRT proteins in fusion events involving lysosomes, endosomes and autophagosomes.
20588296 2010 Membrane budding and scission by the ESCRT machinery: it's all in the neck.
19819239 2009 The interaction between EAP30 and ELL is modulated by MCM2.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18539118 2008 Integrated structural model and membrane targeting mechanism of the human ESCRT-II complex.
18031739 2008 Differential functions of Hrs and ESCRT proteins in endocytic membrane trafficking.
17959629 2007 RILP is required for the proper morphology and function of late endosomes.
17714434 2007 Vps22/EAP30 in ESCRT-II mediates endosomal sorting of growth factor and chemokine receptors destined for lysosomal degradation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17010938 2006 RILP interacts with VPS22 and VPS36 of ESCRT-II and regulates their membrane recruitment.
16973552 2006 Human ESCRT-II complex and its role in human immunodeficiency virus type 1 release.
16857164 2006 RILP interacts with the VPS22 component of the ESCRT-II complex.
16371348 2006 Degradation of endocytosed epidermal growth factor and virally ubiquitinated major histocompatibility complex class I is independent of mammalian ESCRTII.
16260042 2006 Rapid identification of 14-3-3-binding proteins by protein microarray analysis.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15755741 2005 Eap45 in mammalian ESCRT-II binds ubiquitin via a phosphoinositide-interacting GLUE domain.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15329733 2004 Structure of the ESCRT-II endosomal trafficking complex.
15218037 2004 The human endosomal sorting complex required for transport (ESCRT-I) and its role in HIV-1 budding.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14519844 2003 Divergent retroviral late-budding domains recruit vacuolar protein sorting factors by using alternative adaptor proteins.
14505570 2003 The protein network of HIV budding.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11278625 2001 Cloning and characterization of ELL-associated proteins EAP45 and EAP20. a role for yeast EAP-like proteins in regulation of gene expression by glucose.
11031247 2000 Secretory protein trafficking and organelle dynamics in living cells.
10419521 1999 Cloning and characterization of the EAP30 subunit of the ELL complex that confers derepression of transcription by RNA polymerase II.