Property Summary

NCBI Gene PubMed Count 62
PubMed Score 205.31
PubTator Score 51.71

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis 1.100 1.8e-03
astrocytoma 1.500 8.6e-04
medulloblastoma, large-cell 1.100 1.2e-04
acute quadriplegic myopathy 1.044 3.2e-06
primary pancreatic ductal adenocarcinoma -1.481 2.0e-04
pancreatic cancer -1.500 5.2e-04

Gene RIF (39)

PMID Text
26997225 This study unravels a novel mechanism of SND1 function and identifies MGLL as a unique tumor suppressor for HCC. MGLL might function as a homeostatic regulator of Akt restraining its activation.
26323317 SND1 is a determinant downstream effector of TNFalpha that contributes to support glycerophospholipid homeostasis in human hepatocellular carcinoma during inflammation.
25985019 we identified a new SND1-BRAF fusion that appeared to be present in a subpopulation of tumor cells.
25965817 it could be concluded that miR-361-5p functions as a tumor-suppressive miRNA through directly binding to SND1
25663449 Single nucleotide polymorphism in SND1 gene is associated with osteosarcoma susceptibility.
25627688 Tudor-SN is a potential substrate of G1/S phase Cyclin-Dependent Kinases, and promotes cell cycle progression by facilitating E2F-1-mediated gene transcription.
25596283 SND1 promoted expression of the E3 ubiquitin ligase Smurf1, leading to RhoA ubiquitination and degradation.
25559396 Tudor-SN regulates the aggregation dynamics of poly(A(+) mRNA-containing stress granules and selectively stabilizes the stress granules-associated mRNA during cellular stress.
25494629 Promoter activity of the cell growth- and RNA-protection associated SND1 gene is up-regulated by ER stress in human hepatoma cells
25405367 we describe the crucial role of SND1 in cancer development and progression, and highlight SND1 as a potential target for therapeutic intervention.
25216670 Study is the first to show a novel regulatory role of SND1, a direct target of miR-184, in glioma progression, suggesting that the miR-184/SND1 axis may be a useful diagnostic and therapeutic tool for malignant glioma.
25010285 Interaction of HIV-1 Gag with staphylococcal nuclease and tudor domain containing 1 (SND1) is identified in a series of six affinity purification/mass spectrometry screens
24981741 MTDH supports the survival of mammary epithelial cells under oncogenic/stress conditions by interacting with and stabilizing SND1.
24815690 Tudor-SN plays an important role in the assembly of AGTR1-3'UTR granules. Moreover, endogenous Tudor-SN knockdown can decrease the recovery kinetics of AGTR1-3'UTR granules.
24155205 High Tudor-SN expression is associated with breast cancer.
23995791 The transcriptional co-activator SND1 is a novel regulator of alternative splicing in prostate cancer cells.
23878061 High SND1 expression is associated with hepatocellular carcinoma.
23770094 SND1 silencing resolved this block in processing and induced an increase in mature miRs. Together, SND1 might be the missing link between hypoxia and the differential regulation of miRNA processing
23160072 a transcriptional network associated to the key transcription factors NF-kappaB, Sp1 and NF-Y that operates in the control of the SND1 gene expression
23065261 The increased expression of MTDH and/or SND1 is closely related to carcinogenesis, progression, and prognosis of colon cancer.
22944692 Interaction of HIV-1 Gag with staphylococcal nuclease and tudor domain containing 1 (SND1) is identified in a series of six affinity purification/mass spectrometry screens
22396537 SND1 promotes tumor angiogenesis in human hepatocellular carcinoma through novel pathway that involves nuclear factor kappaB and miR-221
21936566 this novel B-Raf fusion protein (SND-1 was identified as the B-Raf fusion partner) presents a novel target with potential clinical implications in the treatment of patients resistant to c-Met inhibitors.
21478147 SND1 as a novel MTDH-interacting protein and shown that it is a functionally and clinically significant mediator of metastasis.
21148275 These results provide evidence that p100 interacts with the 3' UTR of dengue virus and is required for normal dengue virus replication.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20643132 The kinetics of assembly of stress granules(SGs) in living cells demonstrated that Tudor-SN co-localizes with G3BP and is recruited to the same SGs in response to different stress stimuli.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20442744 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20225206 The coacitivator p100 protein can interact with STAT6 through its SN domain both in vivo and in vitro, resulting in enhancement of STAT6-mediated gene transcriptional acitivation.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19435788 SND! represents promising prostate cancer biomarker and therapeutic target.
18453631 Tudor-SN requires tandem repeats of SN domains for its RNA binding and cleavage activity.
17909068 Data showed remarkable up-regulation of SND1 mRNA in human colon cancer tissues, even in early-stage lesions, and also in colon cancer cell lines.
17632523 The tudor and SN (TSN) domain of p100 interacts with U small nuclear ribonucleoprotein (snRNP) complexes, suggesting a role for p100 in the processing of precursor messenger RNA.
17576664 The p100 protein is a novel dual function regulator of gene expression that participates via distinct domains in both transcription and splicing.
15695802 p100 has an important role in the assembly of STAT6 transcriptosome, and that p100 stimulates IL-4-dependent transcription by mediating interaction between STAT6 and CBP and recruiting chromatin modifying activities to STAT6-responsive promoters
12234934 These findings identify p100 as a novel coactivator for STAT6 and suggest that p100 functions as a bridging factor between STAT6 and the basal transcription machinery.

AA Sequence

MASSAQSGGSSGGPAVPTVQRGIIKMVLSGCAIIVRGQPRGGPPPERQINLSNIRAGNLARRAAATQPDA      1 - 70
KDTPDEPWAFPAREFLRKKLIGKEVCFTIENKTPQGREYGMIYLGKDTNGENIAESLVAEGLATRREGMR     71 - 140
ANNPEQNRLSECEEQAKAAKKGMWSEGNGSHTIRDLKYTIENPRHFVDSHHQKPVNAIIEHVRDGSVVRA    141 - 210
LLLPDYYLVTVMLSGIKCPTFRREADGSETPEPFAAEAKFFTESRLLQRDVQIILESCHNQNILGTILHP    211 - 280
NGNITELLLKEGFARCVDWSIAVYTRGAEKLRAAERFAKERRLRIWRDYVAPTANLDQKDKQFVAKVMQV    281 - 350
LNADAIVVKLNSGDYKTIHLSSIRPPRLEGENTQDKNKKLRPLYDIPYMFEAREFLRKKLIGKKVNVTVD    351 - 420
YIRPASPATETVPAFSERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNG    421 - 490
KGLHSKKEVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLITFLLAGIEC    491 - 560
PRGARNLPGLVQEGEPFSEEATLFTKELVLQREVEVEVESMDKAGNFIGWLHIDGANLSVLLVEHALSKV    561 - 630
HFTAERSSYYKSLLSAEEAAKQKKEKVWAHYEEQPVEEVMPVLEEKERSASYKPVFVTEITDDLHFYVQD    631 - 700
VETGTQLEKLMENMRNDIASHPPVEGSYAPRRGEFCIAKFVDGEWYRARVEKVESPAKIHVFYIDYGNRE    701 - 770
VLPSTRLGTLSPAFSTRVLPAQATEYAFAFIQVPQDDDARTDAVDSVVRDIQNTQCLLNVEHLSAGCPHV    771 - 840
TLQFADSKGDVGLGLVKEGLVMVEVRKEKQFQKVITEYLNAQESAKSARLNLWRYGDFRADDADEFGYSR    841 - 910
//

Text Mined References (73)

PMID Year Title
26997225 2016 Staphylococcal Nuclease and Tudor Domain Containing 1 (SND1 Protein) Promotes Hepatocarcinogenesis by Inhibiting Monoglyceride Lipase (MGLL).
26323317 2015 Profiling of promoter occupancy by the SND1 transcriptional coactivator identifies downstream glycerolipid metabolic genes involved in TNF? response in human hepatoma cells.
25985019 2015 Common Oncogene Mutations and Novel SND1-BRAF Transcript Fusion in Lung Adenocarcinoma from Never Smokers.
25965817 2015 MiR-361-5p inhibits colorectal and gastric cancer growth and metastasis by targeting staphylococcal nuclease domain containing-1.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25663449 2015 Polymorphisms in miRNA processing genes and their role in osteosarcoma risk.
25627688 2015 Tudor staphylococcal nuclease (Tudor-SN), a novel regulator facilitating G1/S phase transition, acting as a co-activator of E2F-1 in cell cycle regulation.
25596283 2015 SND1 Acts Downstream of TGF?1 and Upstream of Smurf1 to Promote Breast Cancer Metastasis.
25559396 2015 Poly(A)(+) mRNA-binding protein Tudor-SN regulates stress granules aggregation dynamics.
25494629 2014 The promoter of cell growth- and RNA protection-associated SND1 gene is activated by endoplasmic reticulum stress in human hepatoma cells.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25405367 2015 Role of the staphylococcal nuclease and tudor domain containing 1 in oncogenesis (review).
25216670 2015 Suppression of miR-184 in malignant gliomas upregulates SND1 and promotes tumor aggressiveness.
24981741 2014 MTDH-SND1 interaction is crucial for expansion and activity of tumor-initiating cells in diverse oncogene- and carcinogen-induced mammary tumors.
24882364 2014 Synaptotagmin 11 interacts with components of the RNA-induced silencing complex RISC in clonal pancreatic ?-cells.
24815690 2014 Human Tudor staphylococcal nuclease (Tudor-SN) protein modulates the kinetics of AGTR1-3'UTR granule formation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24155205 2013 MicroRNA-127 is downregulated by Tudor-SN protein and contributes to metastasis and proliferation in breast cancer cell line MDA-MB-231.
23995791 2014 The transcriptional co-activator SND1 is a novel regulator of alternative splicing in prostate cancer cells.
23878061 2013 SND1 affects proliferation of hepatocellular carcinoma cell line SMMC-7721 by regulating IGFBP3 expression.
23770094 2013 Regulation of miR-17-92a cluster processing by the microRNA binding protein SND1.
23532257 2013 Genome-wide association study in a Chinese population identifies a susceptibility locus for type 2 diabetes at 7q32 near PAX4.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23160072 2013 NF-?B, Sp1 and NF-Y as transcriptional regulators of human SND1 gene.
23065261 2012 Prognostic impact of Metadherin-SND1 interaction in colon cancer.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22745804 2012 A novel SND1-BRAF fusion confers resistance to c-Met inhibitor PF-04217903 in GTL16 cells through [corrected] MAPK activation.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22396537 2012 Multifunction protein staphylococcal nuclease domain containing 1 (SND1) promotes tumor angiogenesis in human hepatocellular carcinoma through novel pathway that involves nuclear factor ?B and miR-221.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21936566 2011 Discovery of a novel B-Raf fusion protein related to c-Met drug resistance.
21478147 2011 Identification of staphylococcal nuclease domain-containing 1 (SND1) as a Metadherin-interacting protein with metastasis-promoting functions.
21269460 2011 Initial characterization of the human central proteome.
21148275 2011 Functional interaction between cellular p100 and the dengue virus 3' UTR.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20643132 2010 Tudor-SN interacts with and co-localizes with G3BP in stress granules under stress conditions.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20484005 2010 The RNA binding protein Tudor-SN is essential for stress tolerance and stabilizes levels of stress-responsive mRNAs encoding secreted proteins in Arabidopsis.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20442744 2010 Linkage and candidate gene studies of autism spectrum disorders in European populations.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20225206 2010 Coactivator P100 protein enhances STAT6-dependent transcriptional activation but has no effect on STAT1-mediated gene transcription.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19435788 2009 Staphylococcal nuclease domain-containing protein 1 as a potential tissue marker for prostate cancer.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18453631 2008 Structural and functional insights into human Tudor-SN, a key component linking RNA interference and editing.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17909068 2007 SND1, a component of RNA-induced silencing complex, is up-regulated in human colon cancers and implicated in early stage colon carcinogenesis.
17632523 2007 The multifunctional human p100 protein 'hooks' methylated ligands.
17576664 2007 Transcriptional co-activator protein p100 interacts with snRNP proteins and facilitates the assembly of the spliceosome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17081065 2006 Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.
16210410 2005 Differential expression profiling of membrane proteins by quantitative proteomics in a human mesenchymal stem cell line undergoing osteoblast differentiation.
15695802 2005 The transcriptional co-activator protein p100 recruits histone acetyltransferase activity to STAT6 and mediates interaction between the CREB-binding protein and STAT6.
15627504 2005 The p100 EBNA-2 coactivator: a highly conserved protein found in a range of exocrine and endocrine cells and tissues in cattle.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12917451 2003 Equine arteritis virus non-structural protein 1, an essential factor for viral subgenomic mRNA synthesis, interacts with the cellular transcription co-factor p100.
12819296 2003 Tudor and nuclease-like domains containing protein p100 function as coactivators for signal transducer and activator of transcription 5.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12234934 2002 Identification of p100 as a coactivator for STAT6 that bridges STAT6 with RNA polymerase II.
11691653 2001 The p100 coactivator is present in the nuclei of mammary epithelial cells and its abundance is increased in response to prolactin in culture and in mammary tissue during lactation.
11124528 2000 Assignment of SND1, the gene encoding coactivator p100, to human chromosome 7q31.3 and rat chromosome 4q23 by in situ hybridization.
9809063 1998 Pim-1 kinase and p100 cooperate to enhance c-Myb activity.
9003410 1997 The human EBNA-2 coactivator p100: multidomain organization and relationship to the staphylococcal nuclease fold and to the tudor protein involved in Drosophila melanogaster development.
7651391 1995 The Epstein-Barr virus nuclear protein 2 acidic domain forms a complex with a novel cellular coactivator that can interact with TFIIE.