Property Summary

Ligand Count 78
NCBI Gene PubMed Count 1,368
PubMed Score 4224.92
PubTator Score 4085.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Parkinson's disease 392 8.284 4.0
Disease Target Count Z-score Confidence
Multiple system atrophy 29 7.076 3.5
Lewy body dementia 4 0.0 5.0
Disease Target Count Z-score Confidence
Alzheimer's disease 658 5.396 2.7

Expression

  Differential Expression (30)

Disease log2 FC p
adult high grade glioma -3.100 5.3e-05
astrocytic glioma -3.700 1.2e-03
Astrocytoma, Pilocytic -1.200 5.7e-03
atypical teratoid / rhabdoid tumor -3.900 4.8e-07
Breast cancer -1.700 1.0e-22
breast carcinoma -1.200 4.5e-04
colon cancer -1.400 4.1e-02
cutaneous lupus erythematosus -1.300 4.5e-03
ependymoma -3.600 7.3e-03
glioblastoma -3.100 1.3e-08
group 3 medulloblastoma -2.100 2.3e-02
head and neck cancer and chronic obstruc... -1.200 2.7e-03
intraductal papillary-mucinous adenoma (... -1.100 3.2e-04
invasive ductal carcinoma -1.100 4.3e-02
lung adenocarcinoma -1.300 1.5e-11
lung cancer -2.100 1.2e-02
malignant mesothelioma -4.600 5.2e-09
medulloblastoma, large-cell -4.600 6.1e-06
non primary Sjogren syndrome sicca 1.100 2.1e-02
non-small cell lung carcinoma -1.100 2.6e-12
oligodendroglioma -2.700 1.1e-02
osteosarcoma -3.938 7.3e-03
ovarian cancer -4.000 1.6e-17
pancreatic cancer 1.600 2.8e-04
pancreatic carcinoma 1.600 2.8e-04
Pick disease -1.400 9.2e-03
primitive neuroectodermal tumor -2.800 4.8e-04
psoriasis -1.500 1.3e-04
tuberculosis 1.600 8.5e-04
urothelial carcinoma -1.800 8.2e-07

Protein-protein Interaction (5)

PDB (18)

Gene RIF (1335)

AA Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAV      1 - 70
VTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA     71 - 140
//

Text Mined References (1372)

PMID Year Title