Property Summary

NCBI Gene PubMed Count 39
PubMed Score 49.08
PubTator Score 29.89

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

Gene RIF (14)

PMID Text
26687946 Disruption of Snapin-PKR2 interaction did not affect PKR2 signaling, but increased the ligand-induced degradation, implying a role of Snapin in the trafficking of PKR2.
24751478 Authors propose that Snapin connects chlamydial inclusions with the microtubule network by interacting with both Chlamydia psittaci IncB and dynein.
23949442 Snapin, a SNAP-25 (synaptosomal-associated protein-25) interacting protein, interacts with LRRK2.
22797916 Our findings reveal that Atg14L, previously considered to be solely a Beclin 1-binding autophagy protein, plays a novel role in the late stage of endocytic trafficking in conjunction with Snapin
22523426 These observations identify Snapin as a novel endogenous TLR2 ligand in rheumatoid arthritis, and thus support a role for persistent TLR2 signalling in pathogenesis.
21917956 These results suggest that Snapin may play a key role in regulating the cellular localization of human cytomegalovirus UL70, leading to modulation of viral DNA synthesis and progeny production.
21356520 PKA-dependent phosphorylation of snapin increases interaction among insulin secretory vesicle-associated proteins, thereby potentiating glucose-stimulated insulin secretion.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19515809 Snapin plays an important role as a linker between the water channel and the t-SNARE complex, leading to the fusion event, and the pairing with specific t-SNAREs is essential for the specificity of membrane recognition and fusion.
19168546 Data describe for the first time the expression of SNAPIN in germ cells which raises possibility that SNAPIN plays an extra role in mammals which is germ cell specific.
17684020 Snapin links the alpha(1A)-AR to TRPC6, augmenting Ca(2+) influx via ROC channels
16980328 results demonstrate that snapin is a binding partner of dysbindin-1 in vitro and in the brain; both dysbindin-1 and snapin are concentrated in tissue enriched in synaptic vesicle membranes and less commonly in postsynaptic densities
15635093 EBAG9 and Snapin have roles in controlling exocytosis processes
12659861 results suggest that RGS7 could play a role in synaptic vesicle exocytosis through its interaction with snapin

AA Sequence

MAGAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINE      1 - 70
DQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSPGK         71 - 136
//

Text Mined References (49)

PMID Year Title
26687946 2016 Snapin interacts with G-protein coupled receptor PKR2.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25898167 2015 BORC, a multisubunit complex that regulates lysosome positioning.
24751478 2014 Chlamydia psittaci inclusion membrane protein IncB associates with host protein Snapin.
23949442 2013 LRRK2 phosphorylates Snapin and inhibits interaction of Snapin with SNAP-25.
23414517 2013 A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22797916 2012 Beclin-1-interacting autophagy protein Atg14L targets the SNARE-associated protein Snapin to coordinate endocytic trafficking.
22523426 2012 SNAPIN: an endogenous Toll-like receptor ligand in rheumatoid arthritis.
22471585 2012 Mutation of Ser-50 and Cys-66 in Snapin modulates protein structure and stability.
22203680 2012 Assembly and architecture of biogenesis of lysosome-related organelles complex-1 (BLOC-1).
21917956 2011 Human cytomegalovirus primase UL70 specifically interacts with cellular factor Snapin.
21356520 2011 Snapin mediates incretin action and augments glucose-dependent insulin secretion.
21269460 2011 Initial characterization of the human central proteome.
21102408 2011 CSN complex controls the stability of selected synaptic proteins via a torsinA-dependent process.
20360068 2010 Systematic analysis of human protein complexes identifies chromosome segregation proteins.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19515809 2009 Syntaxin specificity of aquaporins in the inner medullary collecting duct.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19168546 2009 The SNARE-associated component SNAPIN binds PUMILIO2 and NANOS1 proteins in human male germ cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18167355 2008 The dystonia-associated protein torsinA modulates synaptic vesicle recycling.
18068530 2008 CREB3L4, INTS3, and SNAPAP are targets for the 1q21 amplicon frequently detected in hepatocellular carcinoma.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17702749 2007 The UT-A1 urea transporter interacts with snapin, a SNARE-associated protein.
17684020 2007 Snapin, a new regulator of receptor signaling, augments alpha1A-adrenoceptor-operated calcium influx through TRPC6.
17182842 2007 BLOC-1 is required for cargo-specific sorting from vacuolar early endosomes toward lysosome-related organelles.
16980328 2006 Dysbindin-1 is a synaptic and microtubular protein that binds brain snapin.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16330323 2005 The HNF-1 target collectrin controls insulin exocytosis by SNARE complex formation.
16213214 2005 Centriolin anchoring of exocyst and SNARE complexes at the midbody is required for secretory-vesicle-mediated abscission.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15862967 2005 Yeast two-hybrid identification of prostatic proteins interacting with human sex hormone-binding globulin.
15635093 2005 EBAG9 adds a new layer of control on large dense-core vesicle exocytosis via interaction with Snapin.
15546961 2005 Novel interaction partners of the TPR/MET tyrosine kinase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15102850 2004 Identification of snapin and three novel proteins (BLOS1, BLOS2, and BLOS3/reduced pigmentation) as subunits of biogenesis of lysosome-related organelles complex-1 (BLOC-1).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12877659 2003 Identification and characterization of Snapin as a ubiquitously expressed SNARE-binding protein that interacts with SNAP23 in non-neuronal cells.
12809483 2003 ST7 is a novel low-density lipoprotein receptor-related protein (LRP) with a cytoplasmic tail that interacts with proteins related to signal transduction pathways.
12659861 2003 Snapin interacts with the N-terminus of regulator of G protein signaling 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107412 2002 Expressed sequence tag analysis of adult human iris for the NEIBank Project: steroid-response factors and similarities with retinal pigment epithelium.
11283605 2001 Phosphorylation of Snapin by PKA modulates its interaction with the SNARE complex.
10195194 1999 Snapin: a SNARE-associated protein implicated in synaptic transmission.