Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.75
PubTator Score 1.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
malignant mesothelioma 3163 5.0e-07
ovarian cancer 8491 2.6e-04
Multiple myeloma 1327 1.4e-03
astrocytic glioma 2241 1.1e-02
oligodendroglioma 2849 2.1e-02
ependymoma 2514 3.6e-02

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.702 1.4e-03
malignant mesothelioma 1.300 5.0e-07
astrocytic glioma -1.500 1.1e-02
ependymoma -1.400 3.6e-02
oligodendroglioma -1.400 2.1e-02
ovarian cancer 1.800 2.6e-04

AA Sequence

MLSRLQELRKEEETLLRLKAALHDQLNRLKVEELALQSMISSRRGDEMLSSHTVPEQSHDMLVHVDNEAS      1 - 70
INQTTLELSTKSHVTEEEEEEEEEESDS                                               71 - 98
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11056176 2001 A map of protein-protein contacts within the small nuclear RNA-activating protein complex SNAPc.
9732265 1998 SNAP19 mediates the assembly of a functional core promoter complex (SNAPc) shared by RNA polymerases II and III.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.