Property Summary

NCBI Gene PubMed Count 17
PubMed Score 3.00
PubTator Score 6.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 1.1e-06
Disease Target Count Z-score Confidence
Panic disorder 55 3.973 2.0

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.100 1.1e-06

Synonym

Accession Q13487 B2RBZ6 D6W663 Q13486 SNAPc subunit 2
Symbols SNAP45
PTFDELTA

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
21444690 The findings invoke a model wherein incomplete DNA synthesis during S phase leads to a DNA damage response and formation of 53BP1-OPT domains in the subsequent G1.
18356157 SNAP45 plays two roles in the cell, one as a subunit of the transcription factor SNAP(c) and another as a factor required for proper mitotic progression

AA Sequence

MKPPPRRRAAPARYLGEVTGPATWSAREKRQLVRLLQARQGQPEPDATELARELRGRSEAEIRVFLQQLK      1 - 70
GRVAREAIQKVHPGGLQGPRRREAQPPAPIEVWTDLAEKITGPLEEALAVAFSQVLTIAATEPVTLLHSK     71 - 140
PPKPTQARGKPLLLSAPGGQEDPAPEIPSSAPAAPSSAPRTPDPAPEKPSESSAGPSTEEDFAVDFEKIY    141 - 210
KYLSSVSRSGRSPELSAAESAVVLDLLMSLPEELPLLPCTALVEHMTETYLRLTAPQPIPAGGSLGPAAE    211 - 280
GDGAGSKAPEETPPATEKAEHSELKSPWQAAGICPLNPFLVPLELLGRAATPAR                    281 - 334
//

Text Mined References (18)

PMID Year Title
21444690 2011 Replication stress induces 53BP1-containing OPT domains in G1 cells.
18356157 2008 Mitotic functions for SNAP45, a subunit of the small nuclear RNA-activating protein complex SNAPc.
16769183 2006 A role for Yin Yang-1 (YY1) in the assembly of snRNA transcription complexes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12621023 2003 The small nuclear RNA-activating protein 190 Myb DNA binding domain stimulates TATA box-binding protein-TATA box recognition.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11318610 2001 A physical and transcript map of the MCOLN1 gene region on human chromosome 19p13.3-p13.2.
11056176 2001 A map of protein-protein contacts within the small nuclear RNA-activating protein complex SNAPc.
9732265 1998 SNAP19 mediates the assembly of a functional core promoter complex (SNAPc) shared by RNA polymerases II and III.
9488448 1998 Simian virus 40 large T antigen interacts with human TFIIB-related factor and small nuclear RNA-activating protein complex for transcriptional activation of TATA-containing polymerase III promoters.
9418884 1998 The large subunit of basal transcription factor SNAPc is a Myb domain protein that interacts with Oct-1.
9003788 1996 Cloning and characterization of SNAP50, a subunit of the snRNA-activating protein complex SNAPc.
8633057 1996 The SNAP45 subunit of the small nuclear RNA (snRNA) activating protein complex is required for RNA polymerase II and III snRNA gene transcription and interacts with the TATA box binding protein.
8524284 1996 Cloning of two proximal sequence element-binding transcription factor subunits (gamma and delta) that are required for transcription of small nuclear RNA genes by RNA polymerases II and III and interact with the TATA-binding protein.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7715707 1995 A TBP-TAF complex required for transcription of human snRNA genes by RNA polymerase II and III.