Property Summary

NCBI Gene PubMed Count 32
PubMed Score 80.39
PubTator Score 174.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytoma -3.600 3.6e-03
posterior fossa group A ependymoma -3.500 9.8e-16
glioblastoma -4.700 8.8e-05
oligodendroglioma -1.900 9.0e-09
medulloblastoma -1.900 2.3e-05
atypical teratoid / rhabdoid tumor -3.800 3.6e-05
medulloblastoma, large-cell -3.600 1.0e-06
primitive neuroectodermal tumor -1.800 1.6e-04
pediatric high grade glioma -4.100 1.0e-06
pilocytic astrocytoma -1.900 6.6e-07
lung carcinoma 4.600 4.4e-70
Pick disease -1.900 1.9e-02
pituitary cancer 1.100 2.2e-05
psoriasis -1.200 2.5e-07

Gene RIF (13)

PMID Text
26412491 To sustain efficient neurotransmission and synaptic vesicle formation, AP180 and VAMP2 are required.
26204806 intrinsically disordered domains are highly potent drivers of membrane curvature
23678185 AP180 depletion by shRNA results in inhibition of the HIV-1 CA uptake by target cells
22639918 AP180 and CALM are endocytic adaptors dedicated to the sorting of small soluble N-ethylmaleimide-sensitive-factor attachment protein receptors. (Review)
22479182 AP180 depletion by shRNA results in inhibition of the HIV-1 CA uptake by target cells
21813615 AP180 depletion by shRNA results in inhibition of the HIV-1 CA uptake by target cells
21808019 unique mechanism of SNARE motif-dependent endocytic sorting and identify the ANTH domain proteins AP180 and CALM as cargo-specific adaptors for synaptobrevin endocytosis
20847448 AP180 is significantly decreased in the hippocampus of Alzheimer's disease patients and in hippocampal neurons of transgenic mice.
20511563 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19450545 RNA interference-mediated knockdown of AP180 reduces the generation of Abeta1-40 and Abeta1-42, whereas CALM knockdown has no effect on Abeta generation.
19086053 Observational study of gene-disease association. (HuGE Navigator)
12493563 AP180 had an overall expression similar to synaptophysin, the immunoreactivity for the two proteins did not always co-localize.

AA Sequence

MSGQTLTDRIAAAQYSVTGSAVARAVCKATTHEVMGPKKKHLDYLIQATNETNVNIPQMADTLFERATNS      1 - 70
SWVVVFKALVTTHHLMVHGNERFIQYLASRNTLFNLSNFLDKSGSHGYDMSTFIRRYSRYLNEKAFSYRQ     71 - 140
MAFDFARVKKGADGVMRTMAPEKLLKSMPILQGQIDALLEFDVHPNELTNGVINAAFMLLFKDLIKLFAC    141 - 210
YNDGVINLLEKFFEMKKGQCKDALEIYKRFLTRMTRVSEFLKVAEQVGIDKGDIPDLTQAPSSLMETLEQ    211 - 280
HLNTLEGKKPGNNEGSGAPSPLSKSSPATTVTSPNSTPAKTIDTSPPVDLFATASAAVPVSTSKPSSDLL    281 - 350
DLQPDFSSGGAAAAAAPAPPPPAGGATAWGDLLGEDSLAALSSVPSEAQISDPFAPEPTPPTTTAEIATA    351 - 420
SASASTTTTVTAVTAEVDLFGDAFAASPGEAPAASEGAAAPATPTPVAAALDACSGNDPFAPSEGSAEAA    421 - 490
PELDLFAMKPPETSVPVVTPTASTAPPVPATAPSPAPAVAAAAAATTAATAAATTTTTTSAATATTAPPA    491 - 560
LDIFGDLFESTPEVAAAPKPDAAPSIDLFSTDAFSSPPQGASPVPESSLTADLLSVDAFAAPSPATTASP    561 - 630
AKVDSSGVIDLFGDAFGSSASEPQPASQAASSSSASADLLAGFGGSFMAPSPSPVTPAQNNLLQPNFEAA    631 - 700
FGTTPSTSSSSSFDPSVFDGLGDLLMPTMAPAGQPAPVSMVPPSPAMAASKALGSDLDSSLASLVGNLGI    701 - 770
SGTTTKKGDLQWNAGEKKLTGGANWQPKVAPATWSAGVPPSAPLQGAVPPTSSVPPVAGAPSVGQPGAGF    771 - 840
GMPPAGTGMPMMPQQPVMFAQPMMRPPFGAAAVPGTQLSPSPTPASQSPKKPPAKDPLADLNIKDFL       841 - 907
//

Text Mined References (35)

PMID Year Title
26412491 2015 Vesicular Synaptobrevin/VAMP2 Levels Guarded by AP180 Control Efficient Neurotransmission.
26204806 2015 Intrinsically disordered proteins drive membrane curvature.
23092984 2012 Genome-wide association of mood-incongruent psychotic bipolar disorder.
22639918 2012 Turning CALM into excitement: AP180 and CALM in endocytosis and disease.
21808019 2011 SNARE motif-mediated sorting of synaptobrevin by the endocytic adaptors clathrin assembly lymphoid myeloid leukemia (CALM) and AP180 at synapses.
20847448 2010 Changed clathrin regulatory proteins in the brains of Alzheimer's disease patients and animal models.
20511563 2010 Novel cleft susceptibility genes in chromosome 6q.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19450545 2009 The clathrin assembly protein AP180 regulates the generation of amyloid-beta peptide.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17762867 2007 The NECAP PHear domain increases clathrin accessory protein binding potential.
16903783 2006 Role of the AP2 beta-appendage hub in recruiting partners for clathrin-coated vesicle assembly.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16254249 2005 Assigning functions to distinct regions of the N-terminus of the prion protein that are involved in its copper-stimulated, clathrin-dependent endocytosis.
15555551 2004 The human pituitary nitroproteome: detection of nitrotyrosyl-proteins with two-dimensional Western blotting, and amino acid sequence determination with mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12847086 2003 ARF6 stimulates clathrin/AP-2 recruitment to synaptic membranes by activating phosphatidylinositol phosphate kinase type Igamma.
12807910 2003 Eps15 homology domain-NPF motif interactions regulate clathrin coat assembly during synaptic vesicle recycling.
12750376 2003 A role for epsin N-terminal homology/AP180 N-terminal homology (ENTH/ANTH) domains in tubulin binding.
12732633 2003 Molecular and functional characterization of clathrin- and AP-2-binding determinants within a disordered domain of auxilin.
12493563 Immunohistochemical characterization of clathrin assembly protein AP180 and synaptophysin in human brain.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11779129 2002 AP180 binds to the C-terminal SH2 domain of phospholipase C-gamma1 and inhibits its enzymatic activity.
10748223 2000 Tandem arrangement of the clathrin and AP-2 binding domains in amphiphysin 1 and disruption of clathrin coat function by amphiphysin fragments comprising these sites.
10579202 1999 Changes in synaptic expression of clathrin assembly protein AP180 in Alzheimer's disease analysed by immunohistochemistry.
10436022 1999 Clathrin assembly lymphoid myeloid leukemia (CALM) protein: localization in endocytic-coated pits, interactions with clathrin, and the impact of overexpression on clathrin-mediated traffic.
10430869 1999 Crystal structure of the alpha appendage of AP-2 reveals a recruitment platform for clathrin-coat assembly.
9734811 1998 Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8063760 1994 Clathrin assembly protein AP-3 is phosphorylated and glycosylated on the 50-kDa structural domain.