Property Summary

NCBI Gene PubMed Count 171
PubMed Score 350.93
PubTator Score 621.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Congenital myasthenic syndrome 28 0.0 4.0
Intellectual disability 573 0.0 4.0
Disease Target Count
congenital myasthenic syndrome 18 1
Disease Target Count
Myasthenic syndrome, congenital, 18 1

Expression

  Differential Expression (22)

Disease log2 FC p
malignant mesothelioma -6.300 3.5e-09
astrocytoma -4.300 1.2e-03
posterior fossa group A ependymoma -5.700 1.1e-14
glioblastoma -5.700 1.2e-04
oligodendroglioma -2.600 3.2e-14
osteosarcoma 2.013 1.4e-08
medulloblastoma -2.300 4.2e-04
cystic fibrosis 2.501 1.6e-05
atypical teratoid / rhabdoid tumor -6.200 2.9e-09
medulloblastoma, large-cell -2.500 2.3e-07
primitive neuroectodermal tumor -2.900 5.4e-05
adrenocortical carcinoma 1.850 1.7e-02
colon cancer -2.100 1.5e-05
Parkinson's disease -1.800 2.0e-02
interstitial cystitis 2.800 4.8e-04
pediatric high grade glioma -4.100 9.0e-07
pilocytic astrocytoma -2.800 1.1e-05
subependymal giant cell astrocytoma -5.160 9.6e-04
nasopharyngeal carcinoma 1.400 1.8e-02
lung carcinoma 5.200 3.5e-51
Alzheimer's disease -2.000 4.9e-02
Pick disease -3.400 1.2e-03

Protein-protein Interaction (1)

Gene RIF (125)

PMID Text
26779543 Snap25 rs363050 (G) allele, which results in a reduced expression of Snap25, is associated with altered glycemic parameters in T2DM possibly because of reduced functionality in the exocytotic machinery leading to suboptimal release of insulin.
26395074 single nucleotide polymorphisms in either the region of NEUROD6 or SNAP25 were significantly associated with Alzheimer's Disease, in APOE4+ females and APOE4+ males, respectively.
26241848 BoNT-A injection, but not Lipotoxin instillation, effectively cleaves SNAP-25 in the suburothelium.
26204769 Patterns of the immunoreactivity with antibodies to SNAP-25, synapsin-I and synaptophysin are completely appropriate to those of adult's OB on the 38-40 weeks of the prenatal development.
25766323 Upon glucose stimulation BAG3 is phosphorylated by FAK and dissociates from SNAP-25 allowing the formation of the SNARE complex, destabilization of the F-actin network and insulin release.
25698757 The results show that the positively charged amino acids at the SNAP-25 C terminus promote tight SNARE complex zippering and are required for high release frequency and rapid release in individual fusion events.
25678324 Data demonstrate a role for SNAP-25 in controlling PSD-95 clustering and open the possibility that genetic reductions of the protein levels may contribute to the pathology through an effect on postsynaptic function and plasticity.
25655772 The expression of SNAP-25 within the enteric nervous system and its downregulation in DD suggest an essential role in enteric neurotransmission and as a marker for impaired synaptic plasticity in enteric neuropathies.
25650683 SNPs in SNAP25 represent a common risk factor of both schizophrenia and major depressive disorder in the Han Chinese population.
25629685 The rs363050 gene polymorphism correlates with decreasing cognitive scores in autistic children.
25445064 SNARE complex genes and their interactions may play a significant role in susceptibility and working memory of ADHD.
25418885 Cerebrospinal fluid SNAP-25 differentiated Alzheimer's disease from controls
25381298 Ile67Asn variant in SNAP25B is pathogenic because it inhibits synaptic vesicle exocytosis
25024311 This study demonstrated that SNAP-25 polymorphisms may be associated with Alzheimer's disease and correlate with alterations in categorical fluency and a reduced localized brain activity.
24885975 The SNAP-25 Ddel T/C genotype was more common in fibromyalgia syndrome patients compared to controls, and it related to behavioral symptoms, personality and psychological disorders.
24778312 direct interaction between TRIM9 and the Netrin-1 receptor DCC as well as a Netrin-1-sensitive interaction between TRIM9 and the SNARE component SNAP25. The interaction with SNAP25 negatively regulates SNARE-mediated exocytosis and axon
24769566 Full-length SNAP25 is cleaved more efficiently by the protease domain of serotype A botulinum neurotoxin than its shorter fragments.
24391914 Association of impulsivity and polymorphic microRNA-641 target sites in the SNAP-25 gene.
24362847 found evidence of the association of SNAP25 and ADHD.
24176595 In conclusion,the present results of a family-based association study do not support a strong role of SNARE genes in adult ADHD
24164654 no associaton with idiopathic generalized epilepsy was found regarding Intron 7 rs1569061 of Syntaxin 1A gene, MnlI rs3746544 and DdeI rs1051312 polymorphisms of SNAP-25 gene compared with healthy subjects
23888754 Significant associations between two SNPs in the SNAP-25 gene (rs363039 and rs363050) and shyness was found.
23872233 A combination of NET1 (rs2242447) and SNAP-25 (rs3746544) is a risk factor for ADHD.
23612411 There was a trend towards the increase in the frequency of an G allele of SNAP-25 in siblings of patients.
23593184 DNA variation at SNAP25 confers risk to attention deficit disorder with hyperactivity.
23463002 AMPK associates with alpha-SNAP, an adapter that enables disassembly of cis-SNARE complexes formed during membrane fusion.
23403573 syntaxin 1 and SNAP-25 cooperate as SNARE proteins to support neuron survival.
23341457 PRIP inhibits regulated exocytosis through the interaction of its C2 domain with syntaxin 1 and SNAP-25, potentially competing with accessory proteins such as synaptotagmin I and by directly inhibiting trans-SNARE complex formation
23242284 There was a loss of SNAP-25 in visual cortex in dementia with Lewy bodies compared to controls.
22940547 There was an association between schizophrenia and the SNAP-25 rs1503112 polymorphism found, which survived correction for multiple testing.
22762387 low IQ group of children has higher frequency of SNAP25 allele, associated with intellectual disability.
22732502 no Alzheimer's Disease-associated differences in SNAP25 promoter DNA methylation were observed
22193912 SNAP25 might represent the first description of an adaptively evolving gene with a role in cognition.
21996783 Data obtained in this preliminary study indicates that rs3746544 'T' SNAP25 allele may have some role in the disease etiology in the studied Indian population
21926557 Letter: incubation of pancreatic islets with fibronectin improves beta cell function via increased expression of syntaxin 1 and SNAP25.
21916482 Forming an acceptor SNARE complex between syntaxin-1A and SNAP-25 weakens but does not abrogate cholesterol-controlled cluster formation and indicates that the reconstitution process results in equal incorporation of protein at either lipid composition.
21756448 DdeI and MnII T/T genotypes of SNAP25 may be a risk factor for antisocial behavior in a Turkish population.
21557260 A novel real-time PCR-based technique was used applying sequence specific TaqMan probes to haplotype the two SNPs. In silico analyses have suggested that the two SNPs might alter microRNA binding and thus have an effect on SNAP-25 production.
21526988 SNAP25a and SNAP25b display distinct developmental and regional expression profiles in rat and human brain.
21497654 The study shows that SNAP25 single nucleotide polymorphisms are associated with hyperactivity in autism spectrum disorders.
21378164 findings explain how N-terminal light chain (LC)/A associates with SNAP-25 on the plasma membrane and provide a basis for LC/A cleavage of SNAP-25 within the SNARE complex
21073671 Prescence of of APOEepsilon4 allele and MAPT H2 haplotype in frontotemporal lobar degeneration had a significant influence on the expression of synaptophysin and SNAP-25
20950795 A novel gene-brain-behavior network was identified in which a genotype located in SNAP25 affects WM and has age-dependent effects on both brain structure and brain activity.
20950795 Observational study of gene-disease association. (HuGE Navigator)
20679152 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20677014 Observational study of gene-disease association. (HuGE Navigator)
20599404 An association is identified between SNAP-25 and attention-deficit hyperactivity disorder (ADHD) in Chinese subjects of Han descent: SNAP-25 is a genetic susceptibility factor for ADHD.
20599404 Observational study of gene-disease association. (HuGE Navigator)
20519516 SNAP23 and SNAP25 palmitoylation is regulated by DHHC palmitoyl transferases
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20333500 Observational study of gene-disease association. (HuGE Navigator)
19913510 This indicates that kinesin-1 facilitates the transport of SNAP-25 containing vesicles as a prerequisite to SNAP-25 driven membrane fusion events.
19858760 This article confirms and expands previous studies suggesting that genes moderate ADHD treatment response. The ADHD outcomes are not unitary but reflect both behavioral and learning domains that are likely influenced by different genes.
19858760 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19806613 SNAP25 is associated with schizophrenia in Irish family and case-control samples
19724880 Data identified three membrane-associated proteins, synaptosomal associated protein 25 (SNAP25), Thy-1 cell surface antigen and zonadhesin, interact with sex hormone binding globulin (SHBG)-ing proteins in the brain.
19721846 Observational study of gene-disease association. (HuGE Navigator)
19713048 hypothesize that these differences are the result of a mechanism involving SNAP-25 polymorphisms and its differential expression in specific brain areas
19695183 The T1065G polymorphism in the SNAP-25 may be associated with ADHD.
19695183 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19557857 Observational study of gene-disease association. (HuGE Navigator)
19506906 Meta-analysis of gene-disease association. (HuGE Navigator)
19352218 Observational study of gene-disease association. (HuGE Navigator)
19193342 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19156089 MnlI SNAP-25 polymorphism effect on the variability of neurocognitive traits in all groups suggests the relationship between this gene and general cognitive ability.
19156089 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19132710 Genetic variation at SNAP25 may be differentially associated with both schizophrenia and attention deficit hyperactivity disorder.
19132710 Observational study of gene-disease association. (HuGE Navigator)
19125158 These results show that variations in SNAP25, associated with an increased gene expression level in prefrontal cortex, might predispose to early-onset BD.
19125158 Observational study of gene-disease association. (HuGE Navigator)
19099826 No association was found between SNAP-25 polymorphisms and ADHD.
19099826 Observational study of gene-disease association. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
19058789 Observational study of gene-disease association. (HuGE Navigator)
19004828 Direct interaction of otoferlin with syntaxin 1A, SNAP-25, and the L-type voltage-gated calcium channel Cav1.3.
18957941 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18821566 Observational study of gene-disease association. (HuGE Navigator)
18821565 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18726138 SNAP-25 genotype may modulate synaptic plasticity and neurogenesis in the left hippocampus
18726138 Observational study of gene-disease association. (HuGE Navigator)
18658150 SNAP-25 substrate peptide (residues 180-183) binds to but bypasses cleavage by catalytically active Clostridium botulinum neurotoxin E
18633321 Expressed in prolactin-producing pituitary adenomas; may play an important role in prolactin release.
18617262 Results suggest that SNAP-25 is up-regulated and implicated in neuritogenesis in human neuroblastoma SH-SY5Y cells treated with the neuropeptide VIP.
18596234 structural and functional implications of linked SNARE motifs in SNAP25
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18512733 SNARE complex-related genes STX1A, VAMP2 and SNAP25 do not play a major role in susceptibility to schizophrenia in the Japanese population
18512733 Observational study of gene-disease association. (HuGE Navigator)
18457912 The expression of the SNARE protein SNAP-25 and its cellular homologue SNAP-23, as well as syntaxin1 and VAMP (vesicle-associated membrane protein) in samples of normal parathyroid tissue, chief cell adenoma, and parathyroid carcinoma, was examined.
18381601 HIV-1 Tat downregulates the pre-synaptic protein SNAP25 expression via neuronal mir-128 in primary cortical neurons
18347838 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18250960 In this German ADHD sample no preferential transmission of either variant could be observed.
18191416 Observational study of gene-disease association. (HuGE Navigator)
18041776 The heterogeneous distribution of SNAP-25 may have important implications not only in relation to the function of the protein as a SNARE
17908175 Two new variants in intron 1 show association with variation in IQ phenotypes in Dutch twins.
17908175 Observational study of gene-disease association. (HuGE Navigator)
17877635 We report a loss of the soluble N-ethylmaleimide-sensitive factor attachment protein receptor (SNARE) protein, synaptosome-associated protein 25 (SNAP 25) in HD brains of grades I-IV.
17501935 Observational study of gene-disease association. (HuGE Navigator)
17455213 Observational study of gene-disease association. (HuGE Navigator)
17455213 evidence supporting the association of previously implicated SNPs (rs3746544, rs1051312) of SNAP-25 to ADHD. Co-morbidity with major depressive disorder may enhance detection of the association between SNAP-25 and ADHD.
17427194 Observational study of gene-disease association. (HuGE Navigator)
17325714 Observational study of gene-disease association. (HuGE Navigator)
17325713 Observational study of gene-disease association. (HuGE Navigator)
17325713 This study provides significant evidence for assoiatetion single nucleude polymorphism in Korean Attention Deficit Hyperactivity Disorder.
16939418 The fact that this protein undergoes Ca2+-induced conformational changes and interacts with SNAP-25 raise the possibility that secretagogin may link Ca2+ signalling to exocytotic processes.
16801949 Observational study of gene-disease association. (HuGE Navigator)
16801949 Variation in single-nucleotide polymorphism is associated with cognitive ability in a Dutch twin study.
16088329 Observational study of gene-disease association. (HuGE Navigator)
16088329 Quantitative analysis of the dimensions of hyperactivity/impulsivity and inattention in the Toronto sample found that both behavioral traits were associated with SNAP25.
15823421 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15752769 However, effects of diazoxide on SNAP-25 protein were nullified by proteasome inhibitors (ALLN, MG-132, and epoxomicin) but not by lysosomal inhibition (NH(4)Cl).
15717291 Observational study of gene-disease association. (HuGE Navigator)
15592454 first structure of a CNT endopeptidase in complex with its target SNARE at a resolution of 2.1 A: botulinum neurotoxin serotype A (BoNT/A) protease bound to human SNAP-25
15121806 SNAP-25 is required for the activation and maintenance of store-mediated calcium entry in platelets
15007392 Observational study of gene-disease association. (HuGE Navigator)
15007392 Association of SNAP-25 with ADHD is largely due to transmission of alleles from paternal chromosomes.
14709554 the syntaxin/SNAP-25 dimer binding to synaptotagmins I and II is mediated by an evolutionarily conserved motif
12814864 SNAP-25 in cerebrospinal fluid is elevated in schizophrenia suggesting that synaptic pathology may be linked with the pathophysiology of schizophrenia.
12691775 In the hippocampus, the level of SNAP-25 protein is significantly less in the schizophrenic group compared to control or bipolar groups.
12660803 trend consistent with biased transmission of the TC haplotype of SNAP-25 in all transmissions and detected a significant distortion (P=0.027) when paternal transmissions were evaluated for attention deficit disorder with hyperactivity
12499044 elevated mRNA levels of SNAP-25 in adult Down Syndrome brain.
12475239 Synaptosome-associated protein of 25 kDa (SNAP25) has been identified as a new kinesin heavy chain (uKHC)-interacting protein.
12403834 This protein modulates Kv2.1 voltage-dependent K(+) channels in neuroendocrine islet beta-cells through an interaction with the channel N terminus.
12114505 SNAP-25 traffics to the plasma membrane by a syntaxin-independent mechanism.
11920846 Identified a novel microsatellite repeat in SNAP-25 and case-control analyses suggest there may be a role of this polymorphism in ADHD.

AA Sequence

MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKD      1 - 70
MKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTND     71 - 140
ARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG        141 - 206
//

Text Mined References (171)

PMID Year Title
26779543 2016 Synaptosomal Protein of 25 kDa (Snap25) Polymorphisms Associated with Glycemic Parameters in Type 2 Diabetes Patients.
26395074 2015 Leveraging existing data sets to generate new insights into Alzheimer's disease biology in specific patient subsets.
26241848 2015 Presence of Cleaved Synaptosomal-Associated Protein-25 and Decrease of Purinergic Receptors P2X3 in the Bladder Urothelium Influence Efficacy of Botulinum Toxin Treatment for Overactive Bladder Syndrome.
26204769 [Development of the Human Olfactory Bulbs in the Prenatal Ontogenesis: an Immunochistochemical Study with Markers of Presynaptic Terminals (anti-SNAP-25, -Synapsin-I, -Synaptophysin)].
25766323 2015 BAG3 regulates formation of the SNARE complex and insulin secretion.
25698757 2015 Positively charged amino acids at the SNAP-25 C terminus determine fusion rates, fusion pore properties, and energetics of tight SNARE complex zippering.
25678324 2015 Reduced SNAP-25 increases PSD-95 mobility and impairs spine morphogenesis.
25655772 2015 SNAP-25 is abundantly expressed in enteric neuronal networks and upregulated by the neurotrophic factor GDNF.
25650683 2015 SNAP25 is associated with schizophrenia and major depressive disorder in the Han Chinese population.
25629685 2015 Association between SNAP-25 gene polymorphisms and cognition in autism: functional consequences and potential therapeutic strategies.
25445064 2015 Synaptosome-related (SNARE) genes and their interactions contribute to the susceptibility and working memory of attention-deficit/hyperactivity disorder in males.
25418885 2014 SNAP-25 is a promising novel cerebrospinal fluid biomarker for synapse degeneration in Alzheimer's disease.
25381298 2014 Mutant SNAP25B causes myasthenia, cortical hyperexcitability, ataxia, and intellectual disability.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
25024311 2014 Possible association between SNAP-25 single nucleotide polymorphisms and alterations of categorical fluency and functional MRI parameters in Alzheimer's disease.
24885975 2014 Synaptosomal-associated protein 25 (Snap-25) gene polymorphism frequency in fibromyalgia syndrome and relationship with clinical symptoms.
24778312 2014 A novel Netrin-1-sensitive mechanism promotes local SNARE-mediated exocytosis during axon branching.
24769566 2014 Cleavage of SNAP25 and its shorter versions by the protease domain of serotype A botulinum neurotoxin.
24391914 2013 Association of impulsivity and polymorphic microRNA-641 target sites in the SNAP-25 gene.
24362847 2014 Evidence of association between SNAP25 gene and attention deficit hyperactivity disorder in a Latin American sample.
24176595 2014 Role of synaptosome-related (SNARE) genes in adults with attention deficit hyperactivity disorder.
24164654 2014 Genetic variants of synaptic vesicle and presynaptic plasma membrane proteins in idiopathic generalized epilepsy.
23888754 [Family-based association study of dopaminergic genes polymorphisms and EAS temperamental traits].
23872233 2013 The relationship between the presence of ADHD and certain candidate gene polymorphisms in a Turkish sample.
23612411 2013 [SNAP-25 and DTNBP1 as candidate genes for cognitive reserve in schizophrenia].
23593184 2013 DNA variation in the SNAP25 gene confers risk to ADHD and is associated with reduced expression in prefrontal cortex.
23463002 2013 ?-SNAP inhibits AMPK signaling to reduce mitochondrial biogenesis and dephosphorylates Thr172 in AMPK? in vitro.
23403573 2013 Cytotoxicity of botulinum neurotoxins reveals a direct role of syntaxin 1 and SNAP-25 in neuron survival.
23341457 2013 PRIP (phospholipase C-related but catalytically inactive protein) inhibits exocytosis by direct interactions with syntaxin 1 and SNAP-25 through its C2 domain.
23242284 2013 Synaptic proteins and choline acetyltransferase loss in visual cortex in dementia with Lewy bodies.
22940547 2013 Preliminary evidence for association between schizophrenia and polymorphisms in the regulatory Regions of the ADRA2A, DRD3 and SNAP-25 Genes.
22762387 2012 Supporting the generalist genes hypothesis for intellectual ability/disability: the case of SNAP25.
22732502 2012 Analysis of SNAP25 mRNA expression and promoter DNA methylation in brain areas of Alzheimer's Disease patients.
22193912 2012 Variants in SNAP25 are targets of natural selection and influence verbal performances in women.
21996783 2012 Role of SNAP25 explored in eastern Indian attention deficit hyperactivity disorder probands.
21926557 2011 Fibronectin enhances soluble N-ethylmaleimide-sensitive factor attachment protein receptor protein expression in cultured human islets.
21916482 2011 Molecular mechanism of cholesterol- and polyphosphoinositide-mediated syntaxin clustering.
21756448 2011 Synaptosomal-associated protein 25 gene polymorphisms and antisocial personality disorder: association with temperament and psychopathy.
21557260 2011 Haplotyping of putative microRNA-binding sites in the SNAP-25 gene.
21526988 2011 Regional and developmental brain expression patterns of SNAP25 splice variants.
21497654 2011 SNAP-25 single nucleotide polymorphisms are associated with hyperactivity in autism spectrum disorders.
21378164 2011 Association of botulinum neurotoxin serotype A light chain with plasma membrane-bound SNAP-25.
21348951 2011 Hypertrophy-associated polymorphisms ascertained in a founder cohort applied to heart failure risk and mortality.
21073671 2011 Synaptic changes in frontotemporal lobar degeneration: correlation with MAPT haplotype and APOE genotype.
20950795 2010 The SNAP25 gene is linked to working memory capacity and maturation of the posterior cingulate cortex during childhood.
20679152 2011 Association among SNAP-25 gene DdeI and MnlI polymorphisms and hemodynamic changes during methylphenidate use: a functional near-infrared spectroscopy study.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20599404 2011 An association study between SNAP-25 gene and attention-deficit hyperactivity disorder.
20519516 2010 Palmitoylation of the SNAP25 protein family: specificity and regulation by DHHC palmitoyl transferases.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20333500 2010 Association between a synaptosomal protein (SNAP-25) gene polymorphism and verbal memory and attention in patients with endogenous psychoses and mentally healthy subjects.
19913510 2010 Kinesin-1 plays a role in transport of SNAP-25 to the plasma membrane.
19858760 2009 A candidate gene analysis of methylphenidate response in attention-deficit/hyperactivity disorder.
19806613 2010 Association study of SNAP25 and schizophrenia in Irish family and case-control samples.
19724880 2009 Identification of sex hormone binding globulin-interacting proteins in the brain using phage display screening.
19721846 2009 Candidate genes involved in neural plasticity and the risk for attention-deficit hyperactivity disorder: a meta-analysis of 8 common variants.
19713048 2009 Neuropsycological gender differences in healthy individuals and in pediatric neurodevelopmental disorders. A role for SNAP-25.
19695183 2009 [Association of 14 polymorphisms in the five candidate genes and attention deficit hyperactivity disorder].
19557857 2009 De novo STXBP1 mutations in mental retardation and nonsyndromic epilepsy.
19546860 2010 The dysbindin-containing complex (BLOC-1) in brain: developmental regulation, interaction with SNARE proteins and role in neurite outgrowth.
19506906 2009 Candidate gene studies of ADHD: a meta-analytic review.
19352218 2009 Candidate gene analysis in an on-going genome-wide association study of attention-deficit hyperactivity disorder: suggestive association signals in ADRA1A.
19193342 2008 Multiple genetic factors in olanzapine-induced weight gain in schizophrenia patients: a cohort study.
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
19156089 2009 [The association of the SNAP-25 gene polymorphism with verbal memory and attention in patients with major psychosis and healthy people].
19132710 2009 Evidence that putative ADHD low risk alleles at SNAP25 may increase the risk of schizophrenia.
19125158 2010 A SNAP25 promoter variant is associated with early-onset bipolar disorder and a high expression level in brain.
19099826 2008 [Association between SNAP-25 gene polymorphism and attention deficit hyperactivity disorder].
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19058789 2009 A common variant in DRD3 receptor is associated with autism spectrum disorder.
19004828 2009 Direct interaction of otoferlin with syntaxin 1A, SNAP-25, and the L-type voltage-gated calcium channel Cav1.3.
18957941 2010 Genome-wide association scan for five major dimensions of personality.
18821566 2008 SNPs in dopamine D2 receptor gene (DRD2) and norepinephrine transporter gene (NET) are associated with continuous performance task (CPT) phenotypes in ADHD children and their families.
18821565 2008 Genome-wide association scan of quantitative traits for attention deficit hyperactivity disorder identifies novel associations and confirms candidate gene associations.
18726138 2008 SNAP-25 genotype influences NAA/Cho in left hippocampus.
18658150 2008 SNAP-25 substrate peptide (residues 180-183) binds to but bypasses cleavage by catalytically active Clostridium botulinum neurotoxin E.
18633321 2008 Immunohistochemical expression of SNAP-25 protein in adenomas of the human pituitary.
18617262 Vasoactive intestinal peptide-induced neuritogenesis in neuroblastoma SH-SY5Y cells involves SNAP-25.
18596234 2008 The structural and functional implications of linked SNARE motifs in SNAP25.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
18512733 2008 No association between tagging SNPs of SNARE complex genes (STX1A, VAMP2 and SNAP25) and schizophrenia in a Japanese population.
18457912 2008 Heterogeneous expression of SNARE proteins SNAP-23, SNAP-25, Syntaxin1 and VAMP in human parathyroid tissue.
18375205 2008 SNAP-25 is also an iron-sulfur protein.
18347838 2008 Associations of SNAP-25 polymorphisms with cognitive dysfunctions in Caucasian patients with schizophrenia during a brief trail of treatment with atypical antipsychotics.
18250960 2008 Allelic variants of SNAP25 in a family-based sample of ADHD.
18191416 2008 SNAP-25 gene polymorphisms and weight gain in schizophrenic patients.
18041776 2008 Heterogeneous expression of SNAP-25 in rat and human brain.
17908175 2008 Common variants underlying cognitive ability: further evidence for association between the SNAP-25 gene and cognition using a family-based study in two independent Dutch cohorts.
17877635 2007 Loss of SNAP-25 and rabphilin 3a in sensory-motor cortex in Huntington's disease.
17501935 2007 Evidence for an association of the dopamine D5 receptor gene on age at onset of attention deficit hyperactivity disorder.
17455213 2007 Investigation of variation in SNAP-25 and ADHD and relationship to co-morbid major depressive disorder.
17427194 2007 Investigation of parent-of-origin effects in ADHD candidate genes.
17325714 2007 No preferential transmission of paternal alleles at risk genes in attention-deficit hyperactivity disorder.
17325713 2007 Support for the MnlI polymorphism of SNAP25; a Korean ADHD case-control study.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16939418 2007 Binding of calcium ions and SNAP-25 to the hexa EF-hand protein secretagogin.
16801949 2006 The SNAP-25 gene is associated with cognitive ability: evidence from a family-based study in two independent Dutch cohorts.
16722236 2006 The role of SNARE proteins in trafficking and function of neurotransmitter transporters.
16672379 2006 CytLEK1 is a regulator of plasma membrane recycling through its interaction with SNAP-25.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16088329 2005 The SNAP25 gene as a susceptibility gene contributing to attention-deficit hyperactivity disorder.
15823421 2005 The SNAP-25 gene may be associated with clinical response and weight gain in antipsychotic treatment of schizophrenia.
15752769 2005 Evidence that insulin secretion influences SNAP-25 through proteasomal activation.
15717291 2005 Support for association between ADHD and two candidate genes: NET1 and DRD1.
15603740 2004 Huntingtin-interacting protein HIP14 is a palmitoyl transferase involved in palmitoylation and trafficking of multiple neuronal proteins.
15592454 2004 Substrate recognition strategy for botulinum neurotoxin serotype A.
15537656 2005 A direct interaction between Cdc42 and vesicle-associated membrane protein 2 regulates SNARE-dependent insulin exocytosis.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15459722 2004 Syntabulin is a microtubule-associated protein implicated in syntaxin transport in neurons.
15217342 2004 The synaptic vesicle cycle.
15121806 2004 A role for SNAP-25 but not VAMPs in store-mediated Ca2+ entry in human platelets.
15007392 2004 Haplotype analysis of SNAP-25 suggests a role in the aetiology of ADHD.
14709554 2004 Synaptotagmin interaction with the syntaxin/SNAP-25 dimer is mediated by an evolutionarily conserved motif and is sensitive to inositol hexakisphosphate.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853575 2003 A dual mechanism controlling the localization and function of exocytic v-SNAREs.
12847087 2003 Hrs regulates early endosome fusion by inhibiting formation of an endosomal SNARE complex.
12814864 2003 Elevated cerebrospinal fluid SNAP-25 in schizophrenia.
12730201 2003 Ca2+-dependent phosphorylation of syntaxin-1A by the death-associated protein (DAP) kinase regulates its interaction with Munc18.
12691775 2003 SNAP-25 reduction in the hippocampus of patients with schizophrenia.
12660803 2003 Biased paternal transmission of SNAP-25 risk alleles in attention-deficit hyperactivity disorder.
12499044 2003 Increased RNA levels of the 25 kDa synaptosomal associated protein in brain samples of adult patients with Down Syndrome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475239 2002 The heavy chain of conventional kinesin interacts with the SNARE proteins SNAP25 and SNAP23.
12459461 2002 Differential phosphorylation of SNAP-25 in vivo by protein kinase C and protein kinase A.
12403834 2002 Synaptosome-associated protein of 25 kilodaltons modulates Kv2.1 voltage-dependent K(+) channels in neuroendocrine islet beta-cells through an interaction with the channel N terminus.
12145319 2002 Amisyn, a novel syntaxin-binding protein that may regulate SNARE complex assembly.
12130530 2002 Vesicle-associated membrane protein 3 (VAMP-3) and VAMP-8 are present in human platelets and are required for granule secretion.
12114505 2002 SNAP-25 traffics to the plasma membrane by a syntaxin-independent mechanism.
12062043 2002 Ca2+-dependent synaptotagmin binding to SNAP-25 is essential for Ca2+-triggered exocytosis.
11832947 2002 Vesicular restriction of synaptobrevin suggests a role for calcium in membrane fusion.
11832227 2002 Three-dimensional structure of the complexin/SNARE complex.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11524423 2001 Spring, a novel RING finger protein that regulates synaptic vesicle exocytosis.
11509230 2001 The survival of motor neurons (SMN) protein interacts with the snoRNP proteins fibrillarin and GAR1.
11493665 2001 FYVE and coiled-coil domains determine the specific localisation of Hrs to early endosomes.
11438521 2001 Induction of neurite outgrowth in PC12 cells by alpha -phenyl-N-tert-butylnitron through activation of protein kinase C and the Ras-extracellular signal-regulated kinase pathway.
11438518 2001 Direct interaction of the Rab3 effector RIM with Ca2+ channels, SNAP-25, and synaptotagmin.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10954418 2000 Membrane localization and biological activity of SNAP-25 cysteine mutants in insulin-secreting cells.
10906076 2000 Synaptosome-associated protein of 25 kilodaltons in oocytes and steroid-producing cells of rat and human ovary: molecular analysis and regulation by gonadotropins.
10886332 2000 Syntaxin 13 is a developmentally regulated SNARE involved in neurite outgrowth and endosomal trafficking.
10825299 2000 Hrs interacts with SNAP-25 and regulates Ca(2+)-dependent exocytosis.
10692432 2000 The C terminus of SNAP25 is essential for Ca(2+)-dependent binding of synaptotagmin to SNARE complexes.
10644766 2000 Targeting of SNAP-25 to membranes is mediated by its association with the target SNARE syntaxin.
10625663 2000 SNIP, a novel SNAP-25-interacting protein implicated in regulated exocytosis.
10373452 1999 EHSH1/intersectin, a protein that contains EH and SH3 domains and binds to dynamin and SNAP-25. A protein connection between exocytosis and endocytosis?
10336434 1999 Mixed and non-cognate SNARE complexes. Characterization of assembly and biophysical properties.
10195194 1999 Snapin: a SNARE-associated protein implicated in synaptic transmission.
10085240 1999 SNAP-25a and -25b isoforms are both expressed in insulin-secreting cells and can function in insulin secretion.
9817754 1998 Syntaxin 13 mediates cycling of plasma membrane proteins via tubulovesicular recycling endosomes.
9556632 1998 Protease resistance of syntaxin.SNAP-25.VAMP complexes. Implications for assembly and structure.
9452464 1998 Targeting of SNAP-23 and SNAP-25 in polarized epithelial cells.
9395480 1997 Mints, Munc18-interacting proteins in synaptic vesicle exocytosis.
9349529 1997 Characterization of the palmitoylation domain of SNAP-25.
9168999 1997 Inhibition of the binding of SNAP-23 to syntaxin 4 by Munc18c.
8999968 1997 Direct interaction of the rat unc-13 homologue Munc13-1 with the N terminus of syntaxin.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8760387 1996 Insulin-responsive tissues contain the core complex protein SNAP-25 (synaptosomal-associated protein 25) A and B isoforms in addition to syntaxin 4 and synaptobrevins 1 and 2.
8692999 1996 Isoform-specific interaction of the alpha1A subunits of brain Ca2+ channels with the presynaptic proteins syntaxin and SNAP-25.
8663154 1996 Identification of a novel syntaxin- and synaptobrevin/VAMP-binding protein, SNAP-23, expressed in non-neuronal tissues.
8661740 1996 Radiation hybrid mapping of SNAP, PCSK2, and THBD (human chromosome 20p).
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8112622 1994 Human cDNA clones encoding two different isoforms of the nerve terminal protein SNAP-25.
8056350 1994 Cloning and sequence analysis of the human SNAP25 cDNA.
7961655 1994 SNAP-25, a t-SNARE which binds to both syntaxin and synaptobrevin via domains that may form coiled coils.
7768895 1995 A novel ubiquitous form of Munc-18 interacts with multiple syntaxins. Use of the yeast two-hybrid system to study interactions between proteins involved in membrane traffic.
7622514 1995 The N-ethylmaleimide-sensitive fusion protein and alpha-SNAP induce a conformational change in syntaxin.