Property Summary

NCBI Gene PubMed Count 77
PubMed Score 134.97
PubTator Score 86.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
acute quadriplegic myopathy 1.287 5.1e-04
aldosterone-producing adenoma -1.174 3.7e-02
Amyotrophic lateral sclerosis 1.082 1.3e-04
astrocytic glioma 1.200 1.0e-02
Astrocytoma, Pilocytic 1.300 5.0e-06
atypical teratoid / rhabdoid tumor 1.200 2.4e-03
dermatomyositis 1.200 6.5e-04
Down syndrome 1.500 1.6e-03
ependymoma 1.100 2.6e-02
Gaucher disease type 1 -1.300 2.9e-02
glioblastoma 1.600 1.5e-03
group 4 medulloblastoma -1.500 1.5e-03
intraductal papillary-mucinous adenoma (... 1.900 6.8e-04
intraductal papillary-mucinous carcinoma... 1.500 4.8e-03
intraductal papillary-mucinous neoplasm ... 1.100 5.5e-03
juvenile dermatomyositis 1.172 8.8e-09
lung carcinoma -1.200 3.0e-19
medulloblastoma, large-cell -1.500 3.1e-06
Multiple myeloma 1.604 3.5e-04
non primary Sjogren syndrome sicca -1.100 5.6e-03
oligodendroglioma 1.100 2.1e-02
osteosarcoma 1.847 1.2e-03
ovarian cancer -2.100 7.1e-06
psoriasis -2.300 2.9e-04
subependymal giant cell astrocytoma 1.886 6.7e-03
Waldenstrons macroglobulinemia 1.554 5.4e-03

Protein-protein Interaction (3)

Gene RIF (27)

AA Sequence

MDNLSSEEIQQRAHQITDESLESTRRILGLAIESQDAGIKTITMLDEQKEQLNRIEEGLDQINKDMRETE      1 - 70
KTLTELNKCCGLCVCPCNRTKNFESGKAYKTTWGDGGENSPCNVVSKQPGPVTNGQLQQPTTGAASGGYI     71 - 140
KRITNDAREDEMEENLTQVGSILGNLKDMALNIGNEIDAQNPQIKRITDKADTNRDRIDIANARAKKLID    141 - 210
S//

Text Mined References (89)

PMID Year Title