Property Summary

NCBI Gene PubMed Count 210
PubMed Score 1564.66
PubTator Score 463.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Heart disease 279 0.0 2.0
Disease Target Count Z-score Confidence
Piebaldism 11 4.055 2.0
Disease Target Count Z-score Confidence
Waardenburg's syndrome 16 4.4 2.2
Disease Target Count
Waardenburg syndrome 2D 1

Expression

Gene RIF (199)

PMID Text
27012210 4-hydroxytamoxifen resistance in breast cancer cells is suppressed by curcumin, which targets the SLUG/Hexokinase 2 pathway
26992741 we demonstrated that rLZ-8 promoted the interaction between MDM2 and Slug, resulting in Slug degradation
26841870 Sox4 was also able to promote b-catenin-mediated transcription of the Slug gene through formation of transcriptional complexes with b-catenin and p300, independent of TCF4 status
26810856 As a consequence, Slug transcription is down-regulated relieving A549 cells from Slug-mediated repression of E-cadherin transcription, thereby diminishing the metastatic potential of these oncogenic Ras-expressing NSCLC cells
26571812 SNAI1 and SNAI2 - transcriptional master-regulators of epithelial-mesenchimal transition
26561320 Studied the role and putative interactors of SNAI2, a slug protein which is involved in the development of cancer progression. Based upon the computational analysis, we consider HNF4A could be a putative candidate to study zinc finger protein slug.
26561205 Data show that patients with high MDA-9/Syntenin and high Slug expressions were associated with poor overall survival compared to those with low expression in lung adenocarcinomas.
26467042 Our study shows an inversed preferential nuclear expression of SLUG, SOX10, and SOX9 in triple negative and non-triple negative cases.
26459371 highly expressed in stromal villi cells of molar disease
26370982 SOX2 Promotes the Epithelial to Mesenchymal Transition of Esophageal Squamous Cells by Modulating Slug Expression through the Activation of STAT3/HIF-alpha Signaling
26292259 Loss of NDRG2 induced the expression of matrix metalloproteinase-19 (MMP-19), which regulated the expression of Slug at the transcriptional level in the epithelial-mesenchymal transition of gallbladder carcinoma cells.
26198055 We found that TWIST1, SNAIL and SLUG are overexpressed in endometriosis
26194471 Data showed a lack of association between circulating tumor cells (CTCs) and expression of epithelial to mesenchymal transition (EMT) factors, TWIST1 and SLUG, in breast tumor suggesting that expression of EMT protein is not surrogate marker of CTCs.
26170144 findings suggest that while the first ZF does not contribute to the transcription-associated functions of Slug, all the remaining four ZFs are involved in regulating the expression of target genes with ZF3 and ZF4 being more crucial than ZF2 or ZF5
26170067 the correlation between FP receptor and Slug was also confirmed immunohistochemically in breast cancer cases.
26124343 SLUG and TWIST expression in IDC was significant higher in stromal cells.
25997702 It plays an important role in not only invasion ability through EMT but also gemcitabine resistance of CD133-positive pancreatic cancer cells.
25982283 we show that SOX2 is a transcriptional target of SLUG. These data establish a novel mechanism of breast tumor initiation involving IMP3 and they provide a rationale for its association with aggressive disease and poor outcome.
25944620 Our results show that HOXB13/SLUG and ALX4/SLUG axes are novel pathways that promote EMT and invasion of ovarian cancer cells.
25928859 SNAI2/SLUG is prognostic of patients' outcome. The strong inverse correlation with ESR1 indicates a significant impact of estrogen receptor pathway regarding these malignant features.
25871397 In glioblastoma cells, SNAI2 was identified as a direct target gene of miR-203. The knockdown of SNAI2 by short hairpin RNA (shRNA) inhibited EMT and drug resistance.
25855378 Consistent with its role as an intermediate filament, vimentin acted as a scaffold to recruit Slug to ERK and promote Slug phosphorylation at serine-87.
25812964 Slug inversely regulated PUMA and p53 expression in both CNE-2 and CNE-2-RES cells.
25784376 High SLUG expression is associated with gastric cancer.
25728945 LCN2 plays an important role in promoting cell migration and invasion of prostate cancer by inducing EMT through the ERK/SLUG axis.
25728608 SLUG regulates PTEN expression in prostate cancer cell lines.
25707493 High SNAI2 expression was significantly correlated with Gastric Cancer.
25686823 SNAI2 expression in selected PCa cells, by regulating their self-renewal
25652255 Study shows the ability of Slug to bind E-boxes of ERalpha promoter region, and thereby to suppress de novo ERalpha synthesis contributing to tumor progression in breast and prostate neoplasm and drug resistance as well.
25645291 Notch1 signaling regulates the epithelial-mesenchymal transition and invasion of breast cancer in a Slug-dependent manner.
25556164 CCL21/CCR7 pathway activates signallings to up-regulate Slug pathway, leading to the occurrence of epithelial-mesenchymal transition process in human chondrosarcoma
25538040 self-renewal versus differentiation of human ESCs (hESCs) in response to Wnt signaling is predominantly determined by a two-layer regulatory circuit involving beta-catenin, E-cadherin, PI3K/Akt, and Slug in a time-dependent manner.
25491625 Inhibition of Slug expression in laryngeal carcinoma cells via knockdown of S100A4 enhances sensitivity to cisplatin.
25339068 Slug promotes progression of hepatocellular carcinoma by promoting sox2 and nanog overexpression.
25337226 Slug influences growth of lung squamous cell carcinomas and has an independent prognostic value in this tumor type.
25322669 Slug, a target gene of miR-140, was examined by luciferase assay.
25317798 Modulation of Slug signaling (and MMP-9 expression) by ERK5 knockdown, inhibited tumor invasion in osteosarcoma cells.
25256553 TSP-1 cooperates with FGF-2 and VEGF/VEGFR-1 in determining melanoma invasion and metastasis, as part of a Slug-independent motility program.
25151968 A novel role of hTERT in stress hormone-induced ovarian cancer aggressiveness through inducing Slug, providing novel biomarkers and potential therapeutic targets for ovarian cancer.
25141863 Functional studies reveal that p21 and p53 cooperate to facilitate Mdm2-dependent Slug degradation and that this p53 function is mimicked by p53(R273H), a mutant lacking trans-activating activity.
25117682 pregnancy-associated mammary stem cells require a TGF-beta2/alphavbeta3/Slug pathway
25100569 the levels of SNAI2 binding to genomic targets determine the differentiation status of epithelial cells
25031719 Slug is a functional target of IMP3 in breast cancers
24984960 Axl exerts the role of tumor metastasis and chemosensitivity through activation of the PI3K/Akt/GSK3beta signaling pathway, which is transcriptionally regulated by Slug.
24894673 Data suggest that macrophages contributed to the decreased expression of E-cadherin by NF-kappaB/Slug protein pathway in hepatocellular carcinomas.
24870796 There was no significant difference in SNAI2 mRNA expression in basal cell carcinoma compared to normal skin tissue.
24830722 Slug promotes survival during metastasis through suppression of Puma-mediated apoptosis.
24760686 we have shown that miR-1 directly targets the Slug gene in chordoma. Restoration of miR-1 suppressed not only proliferation, but also migratory and invasive activities, and reduced the Slug expression in chordoma cells.
24721839 High expression of slug was correlated with salivary adenoid cystic cancer.
24712489 Slug silencing showed a pro-chondrogenic effect, highlighting both its potential use as an alternative to TGFbeta treatment, and the critical role of the Slug TF in determining the fate of hMSCs.
24662826 Results indicate that Slug has multifaceted roles in cancer progression by controlling both epithelial-mesenchymal transition and genome stability.
24662746 Androgen receptor signaling promotes bladder cancer metastasis through Slug mediated epithelial-mesenchymal transition.
24657653 NOR1 suppresses slug/vimentin expression to inhibit epithelial-mesenchymal transformation in nasopharyngeal carcinoma.
24638100 SNAI1, SNAI2, SNAI3 show unequal oncogenic potential, strictly correlating with their ability to promote epithelial-to-mesenchymal transition.
24549638 SLUG and MSX2, transcription factors involved in epithelial-mesenchymal transitions, essential features of gastrulation in development and tumor progression, are important mediators of BMP4-induced differentiation in human embryonic stem cells.
24469056 Altogether, our study uncovered the existence of a novel Akt-HSF-1 signaling axis that leads to Slug upregulation and EMT, and potentially contributes to progression of HER2-positive breast cancer
24427353 the evaluation of HIF-1alpha, MT and SLUG expression in papillary thyroid carcinoma may be useful in predicting the risk of lymph node metastasis and high TNM stage.
24403312 Loss of slug expression is associated with breast and lung cancer.
24379252 mutations of MITF, SNAI2 and SOX10 genes are observed in Waardenburg syndrome type II. mutation of the KIT gene and/or heterozygous deletion of the SNAI2 gene result in piebaldism disease(review)
24367561 Alterations in Slug expression occur in early stages of development of esophageal squamous cell carcinoma and are sustained during disease progression
24280681 MiR-204 inhibits epithelial to mesenchymal transition by targeting Slug protein in intrahepatic cholangiocarcinoma cells.
24233839 findings indicate that Gas6/Axl regulates tumor invasion through the transcriptional activation of Slug
24210586 Snai2 is downregulated by glyoxal in a process that causes defective keratinocyte migration
24100634 ETV1 expression is significantly correlated with Snail expression in human gastric tumor samples. In summary, we present data that ETV1 promotes Snail expression to induce EMT-like metastatic progression in gastric cancer.
24036252 The Slug/beta-catenin-dependent activation of DNA damage signaling triggered by the hypoxic microenvironment sustains the proinflammatory phenotype of breast cancer stem cells.
24027338 Host Kruppel-like factor 15, Slug, and SPDEF, stimulated the herpes simplex virus type 1 ICP0 promoter more than 150-fold.
24001454 Increased expression of Slug is associated with lymph node metastasis in colorectal cancer.
23996472 High Slug expression is associated with radioresitance in colorectal cancer.
23992520 Our results show that a Slug-dependent endothelial mesenchymal transition process is involved in bleomycin-induced therapeutic effects on endothelial cells and indicate the potential role of this process in the sclerotherapy of venous malformations.
23911747 MiR-181a regulates the MAPK-Snai2 pathway.
23900394 Downregulation of SLUG protein expression significantly inhibits growth and invasion of colorectal cancer cells in vitro.
23873763 high basal levels of Slug prevent the chondrogenic differentiation of human mesenchymal stem cell.
23856093 VAV1 overexpression in both SKOV3 and human ovarian surface epithelial cells demonstrated that its upregulation of an E-cadherin transcriptional repressor, Snail and Slug, was not confined to ovarian cancer cells
23856032 FOXM1 promotes epithelial to mesenchymal transition (EMT) in breast cancer cells by stimulating the transcription of EMT-related genes such as Slug.
23815612 slug induced the increase and maintenance of cancer stem cell subpopulation and contributed to vasculogenic mimicry formation eventually.
23743248 slug has a role in a PI3 kinase pathway that promotes endothelial survival via notch activation
23677639 Data indicate that pancreatic (pro)enzymes enhanced expression of beta-catenin and E-cadherin and decreased expression of several epithelial-mesenchymal transition (EMT)-associated genes, such as Vimentin, Snail and Slug.
23634282 Slug mediates an aggressive phenotype including enhanced migration activity, anoikis suppression, and tumor growth, but increases sensitivity to tubulin-binding agents via the downregulation of betaIII and betaIVa-tubulin in lung cancer cells.
23567973 Gas6 induced the activation of JNK and ERK1/2 signaling in cancer cells expressing Axl, resulting in the phosphorylation of activator protein-1 (AP-1) transcription factors c-Jun and ATF-2, and induction of Slug.
23566666 benzo[a]pyrene regulates the invasive properties of rheumatoid arthritis (RA) fibroblast-like synoviocytes through Slug expression and may provide a a link between smoking and increased progression in RA.
23521708 The staining intensities of Snail and Slug are associated with decreased E-cadherin staining in SCC and this may promote EMT. However, the staining intensities of p53 and p63 are not significantly correlated with the loss of E-cadherin.
23447531 the SNAI2 and miR-203 regulatory loop plays important roles in EMT and tumor metastasis.
23438693 binding of Mdm2 to the Slug mRNA appears to provide a novel mechanism through which Mdm2 promotes tumor progression in a manner independent of the presence of p53.
23434592 ANGPTL1 represses lung cancer cell motility by abrogating the expression of the epithelial mesenchymal transformation mediator SLUG.
23430442 Sox2 expression in hepatocellular carcinoma patients correlates with transcription activity of the SLUG promoter region.
23410973 High SNAI2 is associated with ovarian cancer.
23354685 miR-182 and miR-203 induce mesenchymal to epithelial transition features and growth factor independent growth via repressing SNAI2 in prostate cells.
23352643 Snail2 promotes osteosarcoma cell motility through remodelling of the actin cytoskeleton and regulates tumor development.
23250725 Data indicate that SLUG silencing increased the interference of radiation on cell cycle distribution and cell killing by 60 % and 80 % in M79 cells after a 2.4 Gy and 5 Gy radiation dose, respectively.
23248240 Data indicate that Slug siRNA suppressed the TGF-beta1-induced integrin alpha3beta1-mediated cell migration ability of squamous cell carcinoma HSC-4 cells.
23244088 High SLUG expression is associated with lung cancer growth and metastasis.
23226515 SFRP2 appears to interact with Slug to affect the apoptosis of hypertrophic scar fibroblasts
23190132 In diffuse large B-cell lymphoma, cytoplasmic Slug expression was linked to a favourable disease outcome, whereas nuclear expression of ZEB1 indicated an adverse outcome.
23142026 Re-expression of miR-1 may be an effective therapy that prevents cancer malignancy by converting cells from a mesenchymal phenotype to an epithelial phenotype via the downregulation of Slug.
23086238 Elf5 inhibits the epithelial-mesenchymal transition in mammary gland development and breast cancer metastasis by transcriptionally repressing Snail2.
23059759 These results suggest that FAM3B-258 promotes colon cancer cell invasion and metastasis through upregulation of Slug.
23052737 It might play an important role in the implantation of metastatic foci.
23031797 These studies suggest that miR-221 expression is, in part, dependent on Slug in breast cancer cells
23029385 The overexpression of SLUG and TWIST with down-regulation of E-cadherin was characteristic findings in hemangiopericytomas and solitary fibrous tumors, but not in meningiomas.
23011797 Findings establish unique functional links between canonical Wnt signaling, Slug expression, EMT, and BRCA1 regulation.
22974478 Ectopic expression of Snail and Twist contributed to lymph node and disseminated metastasis, respectively, by reducing E-cadherin expression, providing a novel role for Snail and Twist in the progression of colorectal cancer.
22937066 Kruppel-like factor 4, a tumor suppressor in hepatocellular carcinoma cells reverts epithelial mesenchymal transition by suppressing slug expression.
22911700 autocrine SPARC maintains heightened SLUG expression in melanoma cells and indicate that SPARC may promote EMT-associated tumor invasion by supporting AKT-dependent upregulation of SLUG.
22899291 we have demonstrated strong diffuse expression of SNAI2 and TWIST1 in the majority of anaplastic thyroid carcinomas but not in normal thyroids, thyroid adenomas or well-differentiated thyroid carcinomas
22886823 High Slug and low E-cadherin expression in basal-like breast cancer (BLBC) correlated with histological grade, TNM stage, and lymphatic metastasis. Poor prognosis of BLBC is associated high Slug and vimentin expression and low E-cadherin levels.
22820858 Invasiveness was significantly correlated to the increased Slug in tumour cells, as well as to increased ASMA, S100A4, and PDGFRbeta in stromal cells.
22801439 Slug regulates cyclin D1 expression by ubiquitin-proteasome pathway in PCa cells
22745193 There is a reciprocal regulation between Slug and AR not only in transcriptional regulation but also in protein bioactivity, and Slug-AR complex plays an important role in accelerating the androgen-independent outgrowth of CRPC.
22727060 GSK-3beta-mediated phosphorylation of Slug/Snail2 controls its turnover and localization during EMT.
22508482 Chromatin immunoprecipitation (ChIP) analysis showed that Slug is a target gene of Egr-1.
22503751 The studies suggest a role for Slug early in the transformation of melanocytes to melanoma cells.
22496452 This study thus implicates SLUG-induced repression of plakoglobin as a motility determinant in highly disseminating breast cancer.
22493711 Gene expression signature of the transcription factor SNAI2 and the putative stem cell marker CD44 are strongly correlated and highly expressed in glioblastomas versus lower grade gliomas.
22490800 Slug is expressed markedly higher while E-cadherin markedly lower in metastatic gastrointestinal stromal tumors.
22471696 Data suggest that Snail expression could be a reliable independent prognostic factor to predict gastric carcinoma progression, which might open a new avenue for potential clinical intervention with functional Snail expression in gastric cancer patients.
22421353 Data indicate that up-regulation of Slug was significantly correlated with a higher tumor stage and the E- to N-cadherin switch in bladder cancer cells and tissues.
22385965 Coexpression of Slug and Sox9 promotes the tumorigenic and metastasis-seeding abilities of human breast cancer cells and is associated with poor patient survival
22288519 None of 20 ordinary glioblastomas showed Slug expression in >10% neoplastic cells.
22232555 Results demonstrate differential effects of Snail and Slug in pancreatic cancer and identify the interplay between Rho signaling and beta1-integrin that regulates the scattering and migration of Snail- and Slug-expressing pancreatic cancer cells.
22232246 ROCK cooperated with ET-1/ET(A)R to promote EMT of human ovarian carcinoma cells through upregulation of SLUG mRNA
22208948 The known, precise and consistent gene composition of this cancer mesenchymal transition signature provides unique opportunities for shedding light on the underlying mechanisms of cancer invasiveness
22178381 Increased expression of Slug was observed in 18.2% of primary NSCLC tumors. Overexpression of Slug in stage I NSCLC was associated with a worse overall survival and correlated with a shorter recurrence-free survival.
22074556 SLUG-mediated migration and invasion in prostate cancer cells
22028892 a global view of the impact of Snail and Slug expression
21809991 Overexpression of Snail, Slug, and dysadherin and activation of Wnt and PI3K/Akt signaling was associated with inactivated E-cadherin in the spindle cells of monophasic fibrous synovial sarcomas.
21808237 Slug protein expression level was negatively correlated with pathological tumor stage, suggesting that Slug was down-regulated in advanced renal cell carcinoma.
21785273 Slug expression in UM-SCC-38 cells induces a mesenchymal phenotype and results in increased motility.
21656704 elevated levels of slug were accompanied by down regulation of E-cadherin in adenocarcinoma cells.
21647877 Snai2 plays major roles in EMT and the progression of SCCOT and may serve as a therapeutic target for patients at risk of metastasis.
21645451 down-regulation of Claudin-7 and overexpression of Slug in lung squamous cell carcinoma and adenocarcinoma
21645238 Slug-silenced cells changed in morphology, decreased in their migration ability, increased Sox9 and Sox5 and decreased Sox6 and STAT1 expression
21632819 ERalpha and ERbeta may act in opposite directions to regulate the Slug-E-cadherin pathway and to affect invasiveness of nonfunctional pituitary adenoma
21599940 Slug down-regulation promotes cell apoptosis and decreases invasion capability in vitro and in vivo. Slug inhibition may represent a novel strategy for treatment of metastatic esophageal squamous cell carcinoma.
21593765 transcriptional activity of ZEB1 is increased by Slug, suggesting a hierarchical organized expression of epithelial mesenchyme transition (EMT) transcription factors through directed activation, triggering an EMT-like process in melanoma.
21532623 HAb18G/CD147 promotes epithelial-mesenchymal transition through TGF-beta signaling and is transcriptionally regulated by Slug.(
21470622 Slug expression in our panel of colon cancer cell lines was inversely correlated with E-cadherin expression and enhanced migration/invasion
21274735 in patients with gastric caancer, expression of E-cadherin and that of Slug were associated with tumor properties, including lymph node metastasis, stage, lymphatic invasion, and venous invasion, as well as with prognosis
21207222 Expression of Snail2 in long bone osteosarcomas correlates with tumour malignancy.
21199805 results show that Twist1 needs to induce Snail2 to suppress the epithelial branch of the EMT program and that Twist1 and Snail2 act together to promote EMT and tumor metastasis
21182836 Results show a positive correlation between CXCL12 signaling and Slug activity, thus corroborating the role of these two proteins in bone cells.
21120639 rAAV2-Slug siRNA transfection resulted in downregulation of the levels of Slug in tumor cells.
21081648 These findings indicate that IKKalpha contributes to the tumor-promoting function of the TGFbeta-SMAD signaling pathway in particular cancers.
21053100 Slug-specific siRNA significantly reduced tumor growth by approximately 60% and inhibited metastasis and angiogenesis in a xenograft mouse model.
21044962 SLUG inhibits the expression of UbcH5c directly through chromatin remodeling and thus, among other downstream effects, elevates the level of cyclin D1
20809941 Demonstrate that twist, snail and slug have inappropriate expression in bladder carcinoma and that this may play a part in the progression of human bladder carcinoma.
20738754 Slug may play an important role in the invasion and metastasis of salivary adenoid cystic carcinoma, and has the potential for being one of the strong invasion and metastasis indicators at presentation of such patients.
20730573 Slug is an important modulator of apoptosis, growth and invasion in esophageal adenocarcinoma
20651304 Data show that mesenchymal to epithelial reverting transition, which is mediated through regulation of Slug, is a clinically significant phenotype in leiomyosarcoma.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20622260 Data show that the proto-oncogene c-Myb controls Slug transcription in tumor cells of different origin. Such a regulatory pathway contributes to the acquisition of invasive properties that are important for the metastatic process.
20594328 High slug is associated with extrahepatic hilar cholangiocarcinoma.
20565806 Identified SNAI2/Slug as a regulator of growth and invasion in human gliomas.
20564361 Slug protein is a negative regulator of proliferation of prostate cancer cells
20509143 The aggressive stem cell-like phenotype of breast cancer cells is induced by inflammatory cytokine TNF-alpha activation SLUG via NFkB/HIF1a, which is further enhanced by the loss of p53 function.
20503457 Results suggest that Slug expression is a novel prognostic marker for intrahepatic cholangiocarcinoma with lymph node metastasis.
20418652 Slug gene facilitates apoptosis of fibroblast-like synoviocytes by increasing Puma transactivation.
20150431 p63 isoforms are regulated by snail and slug transcription factors in human squamous cell carcinoma
20138990 transcription factors Snail1 and Snail2 repress vitamin D receptor during colon cancer progression
20128911 Results suggest that SLUG expression is correlated with osteogenic commitment, and is positively regulated by Lef-1 signal in normal human osteoblasts.
20101232 Data show there was a strong inverse correlation between slug and ERalpha and E-cadherin immunoreactivity in breast cancer cases.
20019845 Studies suggest a model of hypoxia induced metastasis through expression of HIF-1alpha, and SLUG regulation of MT4-MMP transcription.
19821482 Coexpression of Snail and Twist correlated with the worst prognosis of hepatocellular carcinoma.
19784072 Data show that elevated Snail expression by Pdcd4 knockdown leads to downregulation of E-cadherin resulting in activating beta-catenin/Tcf-dependent transcription.
19756381 Slug functions as a novel regulator of osteoblast activity and may be considered a new factor required for osteoblast maturation.
19751508 aids in Wnt/beta-catenin signal transduction in invasive ductal carcinoma of breast
19681038 TGF-beta1 increases Slug via ERK1/2 signaling, and thereby contributes to oral squamous cell carcinoma progression.
19502595 Overexpression of Snail2 cooperates with Snail1 in the repression of vitamin D receptor in colon cancer.
19460752 Knockdown of snail homolog 2 (Drosophila) (SNAI2) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19448627 Results indicate that wtp53 and p53 mutants may differentially control cancer invasion and metastasis through the p53-MDM2-Slug pathway.
19389926 changes in the Akt/beta-catenin pathway play key roles in the regulation of E-cadherin through the transactivation of the Slug gene in uterine carcinosarcomas.
19381684 We found upregulation of mRNA for transcription factors Snail, Slug, Twist, and SIP1 in spindle cell carcinoma when compared to squamous cell carcinoma.
19046938 Factors released by breast cancer cells are able to upregulate Slug expression in vascular endothelial cells.
18853422 SLUG-induced epithelial-mesenchymal transition may alter the expression profile of receptor tyrosine kinases, including discoid domain receptors
18799618 Snail and Slug promote formation of beta-catenin-T-cell factor (TCF)-4 transcription complexes that bind to the promoter of the TGF-beta3 gene to increase its transcription.
18716062 These results implicate a novel EGFR/Erk5/Slug pathway in the control of cytoskeleton organization and cell motility in keratinocytes treated with epidermal growth factor.
18685621 Slug is an essential component of the pathway leading to EGFR-mediated epithelial outgrowth
18663143 Collectively, our data suggest that combined expression of Slug and Snail is required for EMT in cardiac cushion morphogenesis.
18628477 Slug down-regulation facilitates apoptosis induced by proapoptotic drugs in neuroblastoma cells and decreases their invasion capability in vitro and in vivo
18588516 The effect of Etrogen receptor alpha on slug repression is dependent on the overall level of ERalpha, confirming that slug is an estrogen receptor alpha responsive gene.
18485278 SLUG binds to the E2-box sequences of the VDR gene promoter and recruits CtBP1 and HDAC1, which results in the inhibition of VDR gene expression by chromatin remodeling.
18256147 HIV-1 Vpu leads to the depression of both total and beta-catenin-associated E-cadherin levels through Vpu-induced upregulation of the transcriptional repressor Snail
18160708 Knockdown of SIM2s in MCF-7 breast cancer cells contributed to an epithelial-mesenchymal transition associated with increased slug levels.
18056415 Myocardin-related transcription factors are critical mediators of transforming growth factor beta (TGF-beta) 1-induced epithelial-mesenchymal transition.[
17984306 Ligand-induced Notch activation, through the induction of Slug, promotes tumor growth and metastasis characterized by epithelial-to-mesenchymal transition.
17724139 Data show that SNAI1 and SNAI2 are ectopically expressed in thyroid carcinomas, and aberrant expression in mice is associated with papillary carcinoma development.
17194444 we provide evidence through yeast two-hybrid and in vitro co-immunoprecipitation analyses that hSLUG does not directly interact with hCtBP1.
16952353 Results suggest that the aryl hydrocarbon receptor participates in Slug induction, which, in turn, regulates cellular physiology including cell adhesion and migration.
16924233 These findings support a role of Slug in mediating Raf 1-induced transcriptional repression of occludin and subsequent epithelial to mesenchymal transition.
16717446 Slug overexpression may contribute to specific cardiac phenotypes and cancer development.
16707493 Slug regulates integrin alpha3, beta1, and beta4 expression and cell proliferation in human epidermal keratinocytes
16541421 SLUG is upregulated by dihydrotestosterone and epidermal growth factor, providing a molecular mechanism by which epithelial cell-specific genes are silenced during prostate cancer development and progression.
16169465 High levels of Snail predict decreased relapse-free survival in women with breast cancer.
15737616 SLUG levels in the cell regulated the function of cytokeratins 8 and 19 gene promoters.
15734731 SLUG is a negative regulator for BRCA2 gene expression
15709186 Tumors with positive Slug expression invaded deeper, had more lymph node metastasis, and had more lymphatic invasion than the tumors with negative Slug expression.
15337769 induction of Slug by autocrine production of SCF and c-Kit activation plays a key role in chemoresistance of malignant mesothelioma
15314165 Results suggest that aberrant expression of Snail or Slug may promote tumorigenesis through increased resistance to programmed cell death.
12444107 Absence of SLUG causes the auditory-pigmentary symptoms in at least some individuals with Wardenburg syndrome type 2.
11912130 The SLUG zinc-finger protein represses E-cadherin in breast cancer.

AA Sequence

MPRSFLVKKHFNASKKPNYSELDTHTVIISPYLYESYSMPVIPQPEILSSGAYSPITVWTTAAPFHAQLP      1 - 70
NGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTF     71 - 140
SGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRTHTLPCVCKICGKAFSRPWLLQGHIRTHTGE    141 - 210
KPFSCPHCNRAFADRSNLRAHLQTHSDVKKYQCKNCSKTFSRMSLLHKHEESGCCVAH                211 - 268
//

Text Mined References (213)

PMID Year Title
27012210 2016 Curcumin suppresses 4-hydroxytamoxifen resistance in breast cancer cells by targeting SLUG/Hexokinase 2 pathway.
26992741 2016 Ling Zhi-8 reduces lung cancer mobility and metastasis through disruption of focal adhesion and induction of MDM2-mediated Slug degradation.
26841870 2016 Cooperation of Sox4 with ?-catenin/p300 complex in transcriptional regulation of the Slug gene during divergent sarcomatous differentiation in uterine carcinosarcoma.
26810856 2016 Aspirin inhibits epithelial-to-mesenchymal transition and migration of oncogenic K-ras-expressing non-small cell lung carcinoma cells by down-regulating E-cadherin repressor Slug.
26571812 [SNAI1 and SNAI2 - transcriptional master-regulators of epithelial-mesenchimal transition].
26561320 2015 Is HNF4A a candidate to study zinc finger protein slug?
26561205 2016 MDA-9/Syntenin-Slug transcriptional complex promote epithelial-mesenchymal transition and invasion/metastasis in lung adenocarcinoma.
26467042 2015 Differential expression of epithelial–mesenchymal transition and stem cell markers in intrinsic subtypes of breast cancer.
26459371 2015 Specific expression patterns of epithelial to mesenchymal transition factors in gestational molar disease.
26370982 2015 SOX2 Promotes the Epithelial to Mesenchymal Transition of Esophageal Squamous Cells by Modulating Slug Expression through the Activation of STAT3/HIF-? Signaling.
26292259 2015 Loss of NDRG2 promotes epithelial-mesenchymal transition of gallbladder carcinoma cells through MMP-19-mediated Slug expression.
26198055 2015 Enhanced epithelial to mesenchymal transition (EMT) and upregulated MYC in ectopic lesions contribute independently to endometriosis.
26194471 2015 Relationship between circulating tumor cells and epithelial to mesenchymal transition in early breast cancer.
26170144 2015 Auto-regulation of Slug mediates its activity during epithelial to mesenchymal transition.
26170067 2015 11?-Prostaglandin F2?, a bioactive metabolite catalyzed by AKR1C3, stimulates prostaglandin F receptor and induces slug expression in breast cancer.
26124343 2015 Expression of EMT Markers SLUG and TWIST in Breast Cancer.
25997702 2015 Slug contributes to gemcitabine resistance through epithelial-mesenchymal transition in CD133(+) pancreatic cancer cells.
25982283 2016 IMP3 promotes stem-like properties in triple-negative breast cancer by regulating SLUG.
25944620 2015 HOXB13 and ALX4 induce SLUG expression for the promotion of EMT and cell invasion in ovarian cancer cells.
25928859 2015 SNAI2/SLUG and estrogen receptor mRNA expression are inversely correlated and prognostic of patient outcome in metastatic non-small cell lung cancer.
25893292 2016 Syntenin regulates TGF-?1-induced Smad activation and the epithelial-to-mesenchymal transition by inhibiting caveolin-mediated TGF-? type I receptor internalization.
25871397 2015 MiR-203 downregulation is responsible for chemoresistance in human glioblastoma by promoting epithelial-mesenchymal transition via SNAI2.
25855378 2015 Vimentin-ERK Signaling Uncouples Slug Gene Regulatory Function.
25812964 2015 Slug mediates nasopharyngeal carcinoma radioresistance via downregulation of PUMA in a p53-dependent and -independent manner.
25784376 2015 Helicobacter pylori-induced epithelial-mesenchymal transition, a potential role of gastric cancer initiation and an emergence of stem cells.
25728945 2015 Over-expression of lipocalin 2 promotes cell migration and invasion through activating ERK signaling to increase SLUG expression in prostate cancer.
25728608 2015 SLUG is a direct transcriptional repressor of PTEN tumor suppressor.
25707493 2015 The miR-506-Induced Epithelial-Mesenchymal Transition is Involved in Poor Prognosis for Patients with Gastric Cancer.
25686823 2015 SNAI2/Slug gene is silenced in prostate cancer and regulates neuroendocrine differentiation, metastasis-suppressor and pluripotency gene expression.
25652255 2015 Slug contributes to cancer progression by direct regulation of ER? signaling pathway.
25645291 2015 Notch1 signaling regulates the epithelial-mesenchymal transition and invasion of breast cancer in a Slug-dependent manner.
25556164 2015 Slug signaling is up-regulated by CCL21/CCR7 [corrected] to induce EMT in human chondrosarcoma.
25538040 2015 A Regulatory Network Involving ?-Catenin, e-Cadherin, PI3k/Akt, and Slug Balances Self-Renewal and Differentiation of Human Pluripotent Stem Cells In Response to Wnt Signaling.
25491625 2014 Knockdown of S100A4 chemosensitizes human laryngeal carcinoma cells in vitro through inhibition of Slug.
25416956 2014 A proteome-scale map of the human interactome network.
25339068 2015 Slug promotes hepatocellular cancer cell progression by increasing sox2 and nanog expression.
25337226 2014 Slug is associated with poor survival in squamous cell carcinoma of the lung.
25322669 2014 Down-regulation of miR-140 induces EMT and promotes invasion by targeting Slug in esophageal cancer.
25317798 2014 ERK5 silencing inhibits invasion of human osteosarcoma cell via modulating the Slug/MMP-9 pathway.
25256553 2015 Thrombospondin-1 is part of a Slug-independent motility and metastatic program in cutaneous melanoma, in association with VEGFR-1 and FGF-2.
25151968 2015 hTERT mediates norepinephrine-induced Slug expression and ovarian cancer aggressiveness.
25141863 2014 Cooperative actions of p21WAF1 and p53 induce Slug protein degradation and suppress cell invasion.
25117682 2014 Integrin ?v?3 drives slug activation and stemness in the pregnant and neoplastic mammary gland.
25100569 2014 SNAI2 controls the undifferentiated state of human epidermal progenitor cells.
25031719 2014 IMP3 expression is associated with epithelial-mesenchymal transition in breast cancer.
24984960 2014 Axl mediates tumor invasion and chemosensitivity through PI3K/Akt signaling pathway and is transcriptionally regulated by slug in breast carcinoma.
24894673 2014 Activated macrophages down-regulate expression of E-cadherin in hepatocellular carcinoma cells via NF-?B/Slug pathway.
24870796 2014 BMI1 and TWIST1 downregulated mRNA expression in basal cell carcinoma.
24830722 2014 Slug promotes survival during metastasis through suppression of Puma-mediated apoptosis.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24760686 2014 MicroRNA-1 (miR-1) inhibits chordoma cell migration and invasion by targeting slug.
24721839 2014 C-kit induces epithelial-mesenchymal transition and contributes to salivary adenoid cystic cancer progression.
24712489 2014 Chondrogenic potential of Slug-depleted human mesenchymal stem cells.
24662826 2015 Slug is temporally regulated by cyclin E in cell cycle and controls genome stability.
24662746 2014 Activated androgen receptor promotes bladder cancer metastasis via Slug mediated epithelial-mesenchymal transition.
24657653 2014 Oxidored-nitro domain containing protein 1 (NOR1) expression suppresses slug/vimentin but not snail in nasopharyngeal carcinoma: Inhibition of EMT in vitro and in vivo in mice.
24638100 2014 Snail family members unequally trigger EMT and thereby differ in their ability to promote the neoplastic transformation of mammary epithelial cells.
24549638 2014 BMP4 promotes EMT and mesodermal commitment in human embryonic stem cells via SLUG and MSX2.
24469056 2015 Akt phosphorylates and activates HSF-1 independent of heat shock, leading to Slug overexpression and epithelial-mesenchymal transition (EMT) of HER2-overexpressing breast cancer cells.
24427353 2014 Overexpression of HIF-1?, metallothionein and SLUG is associated with high TNM stage and lymph node metastasis in papillary thyroid carcinoma.
24403312 2014 hRAD9 functions as a tumor suppressor by inducing p21-dependent senescence and suppressing epithelial-mesenchymal transition through inhibition of Slug transcription.
24379252 2013 [Hereditary hypomelanocytoses: the role of PAX3, SOX10, MITF, SNAI2, KIT, EDN3 and EDNRB genes].
24367561 2013 Slug is a predictor of poor prognosis in esophageal squamous cell carcinoma patients.
24280681 2013 miR-204 inhibits epithelial to mesenchymal transition by targeting slug in intrahepatic cholangiocarcinoma cells.
24233839 2014 Gas6/Axl pathway promotes tumor invasion through the transcriptional activation of Slug in hepatocellular carcinoma.
24210586 2014 Glyoxal leads to defective keratinocyte migration and down-regulation of Snai2.
24100634 2013 ETV1 induces epithelial to mesenchymal transition in human gastric cancer cells through the upregulation of Snail expression.
24036252 2013 Slug/?-catenin-dependent proinflammatory phenotype in hypoxic breast cancer stem cells.
24027338 2013 Stress-induced cellular transcription factors expressed in trigeminal ganglionic neurons stimulate the herpes simplex virus 1 ICP0 promoter.
24001454 2013 Increased expression of Slug and Vimentin as novel predictive biomarkers for lymph node metastasis and poor prognosis in colorectal cancer.
23996472 2014 Slug expression inhibits calcitriol-mediated sensitivity to radiation in colorectal cancer.
23992520 2013 Bleomycin induces endothelial mesenchymal transition through activation of mTOR pathway: a possible mechanism contributing to the sclerotherapy of venous malformations.
23911747 2013 MicroRNA-181a suppresses salivary adenoid cystic carcinoma metastasis by targeting MAPK-Snai2 pathway.
23900394 2013 Knockdown of Slug by RNAi inhibits the proliferation and invasion of HCT116 colorectal cancer cells.
23873763 2015 Chondrogenic potential of human mesenchymal stem cells and expression of Slug transcription factor.
23856093 2013 VAV1 represses E-cadherin expression through the transactivation of Snail and Slug: a potential mechanism for aberrant epithelial to mesenchymal transition in human epithelial ovarian cancer.
23856032 2013 FOXM1 promotes the epithelial to mesenchymal transition by stimulating the transcription of Slug in human breast cancer.
23815612 2013 Slug promoted vasculogenic mimicry in hepatocellular carcinoma.
23743248 2013 Notch activation promotes endothelial survival through a PI3K-Slug axis.
23677639 2013 In vitro treatment of carcinoma cell lines with pancreatic (pro)enzymes suppresses the EMT programme and promotes cell differentiation.
23634282 2013 Slug increases sensitivity to tubulin-binding agents via the downregulation of ?III and ?IVa-tubulin in lung cancer cells.
23567973 2013 Gas6 induces cancer cell migration and epithelial-mesenchymal transition through upregulation of MAPK and Slug.
23566666 2013 A role for benzo[a]pyrene and Slug in invasive properties of fibroblast-like synoviocytes in rheumatoid arthritis: a potential molecular link between smoking and radiographic progression.
23521708 2013 Levels of the EMT-related protein Snail/Slug are not correlated with p53/p63 in cutaneous squamous cell carcinoma.
23447531 2013 Signaling between transforming growth factor ? (TGF-?) and transcription factor SNAI2 represses expression of microRNA miR-203 to promote epithelial-mesenchymal transition and tumor metastasis.
23438693 2013 Mdm2 increases cellular invasiveness by binding to and stabilizing the Slug mRNA.
23434592 2013 Angiopoietin-like protein 1 suppresses SLUG to inhibit cancer cell motility.
23430442 2013 Sox2 expression predicts poor survival of hepatocellular carcinoma patients and it promotes liver cancer cell invasion by activating Slug.
23410973 2013 Integrated analyses identify a master microRNA regulatory network for the mesenchymal subtype in serous ovarian cancer.
23354685 2013 MiR-182 and miR-203 induce mesenchymal to epithelial transition and self-sufficiency of growth signals via repressing SNAI2 in prostate cells.
23352643 2013 Snail2 promotes osteosarcoma cell motility through remodelling of the actin cytoskeleton and regulates tumor development.
23250725 2013 SLUG silencing increases radiosensitivity of melanoma cells in vitro.
23248240 2013 Transforming growth factor-?1 induces epithelial-mesenchymal transition and integrin ?3?1-mediated cell migration of HSC-4 human squamous cell carcinoma cells through Slug.
23244088 2012 Lentivirus-mediated shRNA interference targeting SLUG inhibits lung cancer growth and metastasis.
23226515 2012 SFRP2 and slug contribute to cellular resistance to apoptosis in hypertrophic scars.
23190132 2013 Biological roles and prognostic values of the epithelial-mesenchymal transition-mediating transcription factors Twist, ZEB1 and Slug in diffuse large B-cell lymphoma.
23142026 2013 MicroRNA-1 targets Slug and endows lung cancer A549 cells with epithelial and anti-tumorigenic properties.
23086238 2012 Elf5 inhibits the epithelial-mesenchymal transition in mammary gland development and breast cancer metastasis by transcriptionally repressing Snail2.
23059759 2013 A non-secretory form of FAM3B promotes invasion and metastasis of human colon cancer cells by upregulating Slug expression.
23052737 2013 Differences in the expression of epithelial-mesenchymal transition related molecules between primary tumors and pulmonary metastatic tumors in colorectal cancer.
23031797 2012 Correlation between Slug transcription factor and miR-221 in MDA-MB-231 breast cancer cells.
23029385 2012 Slug, twist, and E-cadherin as immunohistochemical biomarkers in meningeal tumors.
23011797 2012 Canonical Wnt signaling regulates Slug activity and links epithelial-mesenchymal transition with epigenetic Breast Cancer 1, Early Onset (BRCA1) repression.
22974478 2013 Snail promotes lymph node metastasis and Twist enhances tumor deposit formation through epithelial-mesenchymal transition in colorectal cancer.
22937066 2012 Krüppel-like factor 4, a tumor suppressor in hepatocellular carcinoma cells reverts epithelial mesenchymal transition by suppressing slug expression.
22911700 2012 The epithelial-mesenchymal transition (EMT) regulatory factor SLUG (SNAI2) is a downstream target of SPARC and AKT in promoting melanoma cell invasion.
22899291 2013 Expression of epithelial-mesenchymal transition regulators SNAI2 and TWIST1 in thyroid carcinomas.
22886823 2013 Dysregulated expression of Slug, vimentin, and E-cadherin correlates with poor clinical outcome in patients with basal-like breast cancer.
22820858 2012 Expression of the E-cadherin repressors Snail, Slug and Zeb1 in urothelial carcinoma of the urinary bladder: relation to stromal fibroblast activation and invasive behaviour of carcinoma cells.
22801439 2012 Slug regulates Cyclin D1 expression by ubiquitin-proteasome pathway in prostate cancer cells.
22745193 2012 Slug, a unique androgen-regulated transcription factor, coordinates androgen receptor to facilitate castration resistance in prostate cancer.
22727060 2012 Functional regulation of Slug/Snail2 is dependent on GSK-3?-mediated phosphorylation.
22508482 2013 Egr-1 mediates epidermal growth factor-induced downregulation of E-cadherin expression via Slug in human ovarian cancer cells.
22503751 2012 Slug expression during melanoma progression.
22496452 2012 High motility of triple-negative breast cancer cells is due to repression of plakoglobin gene by metastasis modulator protein SLUG.
22493711 2012 A multi-cancer mesenchymal transition gene expression signature is associated with prolonged time to recurrence in glioblastoma.
22490800 2012 [Expression and significance of Slug, E-cadherin and N-cadherin in gastrointestinal stromal tumors].
22471696 2012 Snail is an independent prognostic predictor for progression and patient survival of gastric cancer.
22421353 2013 Slug contributes to cadherin switch and malignant progression in muscle-invasive bladder cancer development.
22385965 2012 Slug and Sox9 cooperatively determine the mammary stem cell state.
22288519 2012 Transcriptional factors for epithelial-mesenchymal transition are associated with mesenchymal differentiation in gliosarcoma.
22232555 2012 Interplay between ?1-integrin and Rho signaling regulates differential scattering and motility of pancreatic cancer cells by snail and Slug proteins.
22232246 2012 ROCK cooperated with ET-1 to induce epithelial to mesenchymal transition through SLUG in human ovarian cancer cells.
22208948 2011 Human cancer cells express Slug-based epithelial-mesenchymal transition gene expression signature obtained in vivo.
22178381 2012 Prognostic role of Twist, Slug, and Foxc2 expression in stage I non-small-cell lung cancer after curative resection.
22074556 2011 SLUG promotes prostate cancer cell migration and invasion via CXCR4/CXCL12 axis.
22028892 2011 The transcription factors Snail and Slug activate the transforming growth factor-beta signaling pathway in breast cancer.
21809991 2011 Immunohistochemical study of correlation between histologic subtype and expression of epithelial-mesenchymal transition-related proteins in synovial sarcomas.
21808237 2011 Expression of Snail and Slug in renal cell carcinoma: E-cadherin repressor Snail is associated with cancer invasion and prognosis.
21785273 Slug (SNAI2) expression in oral SCC cells results in altered cell-cell adhesion and increased motility.
21656704 2013 Slug regulates E-cadherin expression in metastatic adenocarcinoma cells isolated from pleural fluid.
21647877 2012 Deregulation of Snai2 is associated with metastasis and poor prognosis in tongue squamous cell carcinoma.
21645451 2011 [The clinical significance of Claudin-7 and slug expression in lung squamous cell carcinoma and adenocarcinoma].
21645238 2012 Role of Slug transcription factor in human mesenchymal stem cells.
21632819 2011 In nonfunctional pituitary adenomas, estrogen receptors and slug contribute to development of invasiveness.
21599940 2011 Slug down-regulation by RNA interference inhibits invasion growth in human esophageal squamous cell carcinoma.
21593765 2011 Transcriptional activation of ZEB1 by Slug leads to cooperative regulation of the epithelial-mesenchymal transition-like phenotype in melanoma.
21532623 2011 HAb18G/CD147 promotes epithelial-mesenchymal transition through TGF-? signaling and is transcriptionally regulated by Slug.
21470622 2011 Slug expression enhances tumor formation in a noninvasive rectal cancer model.
21274735 2011 Increased Slug and decreased E-cadherin expression is related to poor prognosis in patients with gastric cancer.
21207222 2011 Expression of Snail2 in long bone osteosarcomas correlates with tumour malignancy.
21199805 2011 Snail2 is an essential mediator of Twist1-induced epithelial mesenchymal transition and metastasis.
21182836 2011 Slug contributes to the regulation of CXCL12 expression in human osteoblasts.
21120639 2011 Slug inhibition upregulates radiation-induced PUMA activity leading to apoptosis in cholangiocarcinomas.
21081648 2010 IKK(?) controls canonical TGF(ß)-SMAD signaling to regulate genes expressing SNAIL and SLUG during EMT in panc1 cells.
21053100 2011 Short interfering RNA directed against Slug blocks tumor growth, metastasis formation, and vascular leakage in bladder cancer.
21044962 2011 SLUG-induced elevation of D1 cyclin in breast cancer cells through the inhibition of its ubiquitination.
20809941 2010 Expression of transcription factors snail, slug, and twist in human bladder carcinoma.
20738754 2010 Expression and importance of zinc-finger transcription factor Slug in adenoid cystic carcinoma of salivary gland.
20730573 2011 Slug regulates proliferation and invasiveness of esophageal adenocarcinoma cells in vitro and in vivo.
20651304 2010 Integrated proteomics and genomics analysis reveals a novel mesenchymal to epithelial reverting transition in leiomyosarcoma through regulation of slug.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20622260 2010 Expression of Slug is regulated by c-Myb and is required for invasion and bone marrow homing of cancer cells of different origin.
20594328 2010 The E-cadherin repressor slug and progression of human extrahepatic hilar cholangiocarcinoma.
20565806 2010 SNAI2/Slug promotes growth and invasion in human gliomas.
20564361 2010 Slug inhibits proliferation of human prostate cancer cells via downregulation of cyclin D1 expression.
20509143 2010 TNFalpha up-regulates SLUG via the NF-kappaB/HIF1alpha axis, which imparts breast cancer cells with a stem cell-like phenotype.
20503457 2010 Clinicopathologic significance of slug expression in human intrahepatic cholangiocarcinoma.
20418652 2010 Slug suppression induces apoptosis via Puma transactivation in rheumatoid arthritis fibroblast-like synoviocytes treated with hydrogen peroxide.
20150431 2010 Regulation of p63 isoforms by snail and slug transcription factors in human squamous cell carcinoma.
20138990 2010 The transcription factors Snail1 and Snail2 repress vitamin D receptor during colon cancer progression.
20128911 2010 SLUG: a new target of lymphoid enhancer factor-1 in human osteoblasts.
20101232 2010 ERalpha signaling through slug regulates E-cadherin and EMT.
20019845 2009 Regulation of membrane-type 4 matrix metalloproteinase by SLUG contributes to hypoxia-mediated metastasis.
19821482 2009 Comprehensive analysis of the independent effect of twist and snail in promoting metastasis of hepatocellular carcinoma.
19784072 2010 Downregulation of E-cadherin is an essential event in activating beta-catenin/Tcf-dependent transcription and expression of its target genes in Pdcd4 knockdown cells.
19756381 2009 Slug gene expression supports human osteoblast maturation.
19751508 2009 Expression analysis of E-cadherin, Slug and GSK3beta in invasive ductal carcinoma of breast.
19681038 2009 Slug is a downstream mediator of transforming growth factor-beta1-induced matrix metalloproteinase-9 expression and invasion of oral cancer cells.
19502595 2009 Snail2 cooperates with Snail1 in the repression of vitamin D receptor in colon cancer.
19448627 2009 p53 controls cancer cell invasion by inducing the MDM2-mediated degradation of Slug.
19389926 2009 Requirement of the Akt/beta-catenin pathway for uterine carcinosarcoma genesis, modulating E-cadherin expression through the transactivation of slug.
19386897 2009 Characterization of Snail nuclear import pathways as representatives of C2H2 zinc finger transcription factors.
19381684 2009 Transcription factors Snail, Slug, Twist, and SIP1 in spindle cell carcinoma of the head and neck.
19046938 2009 Tumor-induced upregulation of Twist, Snail, and Slug represses the activity of the human VE-cadherin promoter.
18853422 2008 Switching in discoid domain receptor expressions in SLUG-induced epithelial-mesenchymal transition.
18799618 2008 Snail and Slug promote epithelial-mesenchymal transition through beta-catenin-T-cell factor-4-dependent expression of transforming growth factor-beta3.
18716062 2008 Erk5 controls Slug expression and keratinocyte activation during wound healing.
18685621 2009 Slug/Snai2 is a downstream mediator of epidermal growth factor receptor-stimulated reepithelialization.
18663143 2008 Slug is a direct Notch target required for initiation of cardiac cushion cellularization.
18628477 2008 Slug (SNAI2) down-regulation by RNA interference facilitates apoptosis and inhibits invasive growth in neuroblastoma preclinical models.
18588516 2008 ERalpha suppresses slug expression directly by transcriptional repression.
18485278 2008 In vivo binding to and functional repression of the VDR gene promoter by SLUG in human breast cells.
18160708 2008 Loss of singleminded-2s in the mouse mammary gland induces an epithelial-mesenchymal transition associated with up-regulation of slug and matrix metalloprotease 2.
18056415 2007 Dual roles of myocardin-related transcription factors in epithelial mesenchymal transition via slug induction and actin remodeling.
17984306 2007 Jagged1-mediated Notch activation induces epithelial-to-mesenchymal transition through Slug-induced repression of E-cadherin.
17724139 2007 Snail family transcription factors are implicated in thyroid carcinogenesis.
17194444 2007 Human SLUG does not directly bind to CtBP1.
16952353 2006 Zinc finger transcription factor Slug is a novel target gene of aryl hydrocarbon receptor.
16924233 2007 Raf 1 represses expression of the tight junction protein occludin via activation of the zinc-finger transcription factor slug.
16717446 2006 SLUG (SNAI2) overexpression in embryonic development.
16707493 2006 Slug regulates integrin expression and cell proliferation in human epidermal keratinocytes.
16541421 2006 Androgen regulation of prostasin gene expression is mediated by sterol-regulatory element-binding proteins and SLUG.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16169465 2005 The transcriptional repressor Snail promotes mammary tumor recurrence.
15737616 2005 Negative regulation of the expressions of cytokeratins 8 and 19 by SLUG repressor protein in human breast cells.
15734731 2005 Regulation of BRCA2 gene expression by the SLUG repressor protein in human breast cells.
15709186 2005 Slug Expression in the E-cadherin preserved tumors is related to prognosis in patients with esophageal squamous cell carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15337769 2004 Induction of stem cell factor/c-Kit/slug signal transduction in multidrug-resistant malignant mesothelioma cells.
15314165 2004 Aberrant expression of the transcription factors snail and slug alters the response to genotoxic stress.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12955764 2003 Deletion of the SLUG (SNAI2) gene results in human piebaldism.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12444107 2002 SLUG (SNAI2) deletions in patients with Waardenburg disease.
11912130 2002 The SLUG zinc-finger protein represses E-cadherin in breast cancer.
10866665 2000 Human Slug is a repressor that localizes to sites of active transcription.
10518215 1999 SLUG, a ces-1-related zinc finger transcription factor gene with antiapoptotic activity, is a downstream target of the E2A-HLF oncoprotein.
10479723 1999 Human transcription factor SLUG: mutation analysis in patients with neural tube defects and identification of a missense mutation (D119E) in the Slug subfamily-defining region.
9721220 1998 Human SLUG gene organization, expression, and chromosome map location on 8q.
9337409 1997 Localization of a neural crest transcription factor, Slug, to mouse chromosome 16 and human chromosome 8.
9182671 1997 The zinc-finger protein slug causes desmosome dissociation, an initial and necessary step for growth factor-induced epithelial-mesenchymal transition.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.