Property Summary

NCBI Gene PubMed Count 259
PubMed Score 1689.35
PubTator Score 463.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Heart disease 306 0.0 2.2
Disease Target Count Z-score Confidence
Waardenburg's syndrome 17 4.486 2.2

Expression

  Differential Expression (22)

 GWAS Trait (1)

Gene RIF (248)

AA Sequence

MPRSFLVKKHFNASKKPNYSELDTHTVIISPYLYESYSMPVIPQPEILSSGAYSPITVWTTAAPFHAQLP      1 - 70
NGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTF     71 - 140
SGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRTHTLPCVCKICGKAFSRPWLLQGHIRTHTGE    141 - 210
KPFSCPHCNRAFADRSNLRAHLQTHSDVKKYQCKNCSKTFSRMSLLHKHEESGCCVAH                211 - 268
//

Text Mined References (262)

PMID Year Title