Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.23
PubTator Score 1.33

Knowledge Summary


No data available


  Disease (2)

Disease Target Count
medulloblastoma 1524
Disease Target Count P-value
adrenocortical carcinoma 1427 2.4e-05
osteosarcoma 7933 4.1e-05


  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.355 4.1e-05
adrenocortical carcinoma -1.168 2.4e-05

Gene RIF (2)

20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19383909 Smyd4, as a potential tumor suppressor, plays a critical role in breast carcinogenesis at least partly through inhibiting the expression of Pdgfr-alpha.

AA Sequence

LSLHCGPWDDEIQELQKMKSCLLDLPPTPVGPAL                                        771 - 804

Text Mined References (12)

PMID Year Title
21248752 2011 Exome sequencing identifies frequent mutation of the SWI/SNF complex gene PBRM1 in renal carcinoma.
20705733 2010 Common variants in the calcium-sensing receptor gene are associated with total serum calcium levels.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19383909 2009 Identification of Smyd4 as a potential tumor suppressor gene involved in breast cancer development.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11752456 2001 Insight into hepatocellular carcinogenesis at transcriptome level by comparing gene expression profiles of hepatocellular carcinoma with those of corresponding noncancerous liver.
11572484 2001 Prediction of the coding sequences of unidentified human genes. XXI. The complete sequences of 60 new cDNA clones from brain which code for large proteins.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.