Property Summary

NCBI Gene PubMed Count 34
PubMed Score 48.78
PubTator Score 30.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
pilocytic astrocytoma 3086 2.8e-05
Pick disease 1893 6.5e-04
astrocytic glioma 2241 1.3e-03
lung cancer 4473 1.5e-03
oligodendroglioma 2849 8.1e-03
Disease Target Count Z-score Confidence
Pneumothorax 17 3.709 1.9

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.900 1.3e-03
oligodendroglioma -1.500 8.1e-03
lung cancer 1.900 1.5e-03
pilocytic astrocytoma -1.300 2.8e-05
Pick disease -1.500 6.5e-04

 GWAS Trait (1)

Gene RIF (23)

PMID Text
26826421 Suggest that SMYD2 plays a role in tumor progression and might be a useful prognosticator in HPV-unrelated, nonmultiple head and neck squamous cell carcinomas.
26488939 Results show that high expression levels of SMYD2, SETD3, and NO66 in renal cell tumors. Their low expression levels were significantly associated with shorter disease-specific and disease-free survival.
25925379 SMYD2-mediated methylation negatively regulates PTEN tumor suppressor activity and results in activation of the phosphatidylinositol 3-kinase-AKT pathway.
25825497 in addition to esophageal squamous cell carcinoma, SMYD2 is also amplified and/or overexpressed in breast and liver primary tumors
25533488 Comprehensive motif-based searches and mutational analysis further established four additional substrates of SMYD2.
25321194 SMYD2 has a crucial role in tumor cell proliferation by its overexpression and highlight its usefulness as a prognostic factor and potential therapeutic target in gastric cancer.
24880080 A novel mechanism for human carcinogenesis via methylation of HSP90AB1 by SMYD2.
24726141 a novel mechanism of PARP1 in human cancer through its methylation by SMYD2
24631370 SMYD2 expression is altered in acute lymphoblastic leukemia bone marrow samples and its high expression was correlated with a bad prognosis. Moreover, SMYD2 expression level significantly decreases in patients that respond to chemotherapy treatment.
24594358 Data indicate that irect estrogen receptor alpha (ERalpha) methylation by histone methyltransferase SMYD2 regulates estrogen signaling.
24101509 Data suggest that SMYD2-mediated estrogen receptor alpha (ERalpha) protein methylation and p300/cAMP response element-binding protein-binding protein-dependent ERalpha acetylation play an important role in the estrogen-induced gene expression profiles.
23873367 Findings suggest that SMYD2 (SET and MYND domain containing protein 2), a histone lysine methyltransferase, in embryonic stem (ES) cell differentiation.
22787429 -dependent RB1 methylation at lysine 810 promotes cell cycle progression of cancer cells. Further study may explore SMYD2-dependent RB1 methylation as a potential therapeutic target in human cancer.
22028380 Data highlights the ability of SMYD proteins to form unique protein complexes that may underlie their various biological functions and the SMYD2-mediated methylation of the key molecular chaperone HSP90.
21880715 SMYD2 has a role in specifically recognizing and regulating functions of p53 tumor suppressor through Lys-370 monomethylation
21782458 Structural basis of substrate methylation and inhibition of SMYD2
21724641 Data report the crystal structure of the full-length human Smyd2 in complex with S-adenosyl-L-homocysteine (AdoHcy).
21678921 Substrate specificity and product analysis studies established SMYD2 as a monomethyltransferase that prefers nonmethylated p53 peptide substrate.
21509594 SMYD2 gene expression is decreased in both classic and follicular variants of papillary thyroid carcinoma.
20870719 RB monomethylation at lysine 860 by SMYD2 provides a direct binding site for L3MBTL1.
19423649 SMYD2 plays an important role in tumor cell proliferation through its activation/overexpression and highlight its usefulness as a prognosticator and potential therapeutic target in ESCC.
19240061 Observational study of gene-disease association. (HuGE Navigator)
18065756 The combination of the SMYD2 interactome with the gene expression data suggests that some of the genes regulated by SMYD2 are closely associated with SMYD2-interacting proteins.

AA Sequence

MRAEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQ      1 - 70
AFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDK     71 - 140
LDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCC    141 - 210
PNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIR    211 - 280
KLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVC    281 - 350
LYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDH    351 - 420
PYISEIKQEIESH                                                             421 - 433
//

Text Mined References (37)

PMID Year Title
26826421 2016 SMYD2 overexpression is associated with tumor cell proliferation and a worse outcome in human papillomavirus-unrelated nonmultiple head and neck carcinomas.
26488939 2015 Expression of histone methyltransferases as novel biomarkers for renal cell tumor diagnosis and prognostication.
25925379 2015 Dysregulation of AKT Pathway by SMYD2-Mediated Lysine Methylation on PTEN.
25825497 2015 LLY-507, a Cell-active, Potent, and Selective Inhibitor of Protein-lysine Methyltransferase SMYD2.
25533488 2015 Discovery of substrates for a SET domain lysine methyltransferase predicted by multistate computational protein design.
25321194 2015 Overexpression of SMYD2 contributes to malignant outcome in gastric cancer.
24880080 2014 SMYD2-dependent HSP90 methylation promotes cancer cell proliferation by regulating the chaperone complex formation.
24726141 2014 The histone methyltransferase SMYD2 methylates PARP1 and promotes poly(ADP-ribosyl)ation activity in cancer cells.
24631370 2014 SMYD2 is highly expressed in pediatric acute lymphoblastic leukemia and constitutes a bad prognostic factor.
24594358 2014 Structural insights into estrogen receptor ? methylation by histone methyltransferase SMYD2, a cellular event implicated in estrogen signaling regulation.
24101509 2013 Regulation of estrogen receptor ? by histone methyltransferase SMYD2-mediated protein methylation.
23873367 2013 SMYD2 is induced during cell differentiation and participates in early development.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22787429 2012 RB1 methylation by SMYD2 enhances cell cycle progression through an increase of RB1 phosphorylation.
22028380 2011 Proteomic analyses of the SMYD family interactomes identify HSP90 as a novel target for SMYD2.
21880715 2011 Structure of human SMYD2 protein reveals the basis of p53 tumor suppressor methylation.
21782458 2011 Structural basis of substrate methylation and inhibition of SMYD2.
21724641 2011 Structure of human lysine methyltransferase Smyd2 reveals insights into the substrate divergence in Smyd proteins.
21678921 2011 Biochemical characterization of human SET and MYND domain-containing protein 2 methyltransferase.
21509594 2011 Differential expression of a set of genes in follicular and classic variants of papillary thyroid carcinoma.
20870719 2010 Methylation of the retinoblastoma tumor suppressor by SMYD2.
19423649 2009 Overexpression of SMYD2 relates to tumor cell proliferation and malignant outcome of esophageal squamous cell carcinoma.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
18065756 2008 The tale of two domains: proteomics and genomics analysis of SMYD2, a new histone methyltransferase.
17805299 2007 p53 is regulated by the lysine demethylase LSD1.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17242690 2007 C/EBPalphap30 plays transcriptional regulatory roles distinct from C/EBPalphap42.
17108971 2006 Repression of p53 activity by Smyd2-mediated methylation.
16805913 2006 Identification and characterization of Smyd2: a split SET/MYND domain-containing histone H3 lysine 36-specific methyltransferase that interacts with the Sin3 histone deacetylase complex.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15743541 2005 JTE-522, a selective COX-2 inhibitor, inhibits growth of pulmonary metastases of colorectal cancer in rats.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.