Property Summary

NCBI Gene PubMed Count 8
PubMed Score 6.05
PubTator Score 8.33

Knowledge Summary


No data available


  Disease (1)

Disease Target Count P-value
acute quadriplegic myopathy 1157 2.0e-03


  Differential Expression (1)

Disease log2 FC p
acute quadriplegic myopathy -1.483 2.0e-03

Gene RIF (2)

26048986 Pregnancy promotes switching of skeletal muscle to a glycolytic phenotype through the smoothelin-like protein 1 transcriptional cofactor.
21352594 The Smtnl1 proximal promoter enhances expression up to 8-fold in smooth muscle cells and a second activating region lays 500 bp further upstream.

AA Sequence

VDDMVRLAVPDSKCVYTYIQELYRSLVQKGLVKTKKK                                     421 - 457

Text Mined References (9)

PMID Year Title
26048986 2015 Pregnancy and Smoothelin-like Protein 1 (SMTNL1) Deletion Promote the Switching of Skeletal Muscle to a Glycolytic Phenotype in Human and Mice.
21352594 2011 Mapping and functional characterization of the murine smoothelin-like 1 promoter.
20634291 2010 Smoothelin-like 1 protein regulates myosin phosphatase-targeting subunit 1 expression during sexual development and pregnancy.
20627103 2010 Tropomyosin-binding properties of the CHASM protein are dependent upon its calponin homology domain.
19219534 2009 The role of the calponin homology domain of smoothelin-like 1 (SMTNL1) in myosin phosphatase inhibition and smooth muscle contraction.
18310078 2008 Deletion of the protein kinase A/protein kinase G target SMTNL1 promotes an exercise-adapted phenotype in vascular smooth muscle.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15327999 2004 Modulation of smooth muscle contractility by CHASM, a novel member of the smoothelin family of proteins.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.