Property Summary

NCBI Gene PubMed Count 32
PubMed Score 104.48
PubTator Score 83.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma -1.600 5.1e-06
adrenocortical carcinoma -1.021 1.5e-05
colon cancer -1.900 7.0e-05
dermatomyositis -1.100 4.1e-03

Gene RIF (16)

PMID Text
24551305 Caldesmon and smoothelin staining allows better delineation of the muscularis propria from the desmoplastic stromal reaction which provides a critical aide for proper staging of colonic adenocarcinomas.
24409061 During development of advanced liver fibrosis, a subpopulation of myofibroblasts expressing smoothelin may be derived from vascular smooth muscle cells.
24043717 The objective of the following study was to record the specificity and sensitivity of alpha5(IV) loss, smoothelin expression and PLAP expression as markers of gastrointestinal smooth muscle neoplasms
23121329 There is an association between essential hypertension and the SMTN gene.
23060305 lower level of expresseion in colonic inertia patients
23033319 Smoothelin haplotype constructed using rs5997872, rs56095120, rs9621187 and rs10304 was a useful genetic marker of cerebral infarction in Japanese men.
22963604 for the Japanese women, the frequency of the C-T-T-G haplotype (established by rs5997872, rs56095120, rs9621187, and rs10304) was significantly higher in the myocardial infarction group than in the control group
22960022 Phenotypic expression of alpha-smooth muscle actin, smooth muscle myosin heavy chain 2, and smoothelin were significantly decreased in the dissected media, whereas that of osteopontin was elevated.
21683983 Smoothelin immunoreactivity in bladder diverticula confirms limited nature of smoothelin expression in muscularis mucosae and represents useful ancillary technique in proper histopathologic evaluation of diverticular and nondiverticular bladder carcinoma
21472682 We report the first study of smoothelin expression in normal skin
21164287 Immunohistochemistry for smoothelin identifies differential staining between the neomuscularis mucosa and the true muscularis mucosa in Barrett's esophagus.
20716166 The expression of smoothelin was analysed immunohistochemically in comparison with alpha-smooth muscle actin (alpha-SMA) in specimens from colon, stomach and oesophagus (n = 107).
20636795 Smoothelin immunohistochemistry has diagnostic utility in the evaluation of muscularis propria invasion in urothelial carcinoma.
20154589 Confirm the relatively distinct staining pattern of smoothelin between muscularis mucosae and muscularis propria and suggest caution when using smoothelin immunohistochemistry as a diagnostic tool.
19950405 Suggest that the extent and pattern of smoothelin expression may help differentiate between benign and malignant mesenchymal tumors of the GI tract.
19252475 immunohistochemistry, using a panel composed of desmin, smoothelin, and vimentin, may be potentially useful for staging of bladder carcinoma.

AA Sequence

MADEALAGLDEGALRKLLEVTADLAERRRIRSAIRELQRQELEREEEALASKRFRAERQDNKENWLHSQQ      1 - 70
REAEQRAALARLAGQLESMNDVEELTALLRSAGEYEERKLIRAAIRRVRAQEIEAATLAGRLYSGRPNSG     71 - 140
SREDSKGLAAHRLEQCEVPEREEQEQQAEVSKPTPTPEGTSQDVTTVTLLLRAPPGSTSSSPASPSSSPT    141 - 210
PASPEPPLEPAEAQCLTAEVPGSPEPPPSPPKTTSPEPQESPTLPSTEGQVVNKLLSGPKETPAAQSPTR    211 - 280
GPSDTKRADVAGPRPCQRSLSVLSPRQPAQNRESTPLASGPSSFQRAGSVRDRVHKFTSDSPMAARLQDG    281 - 350
TPQAALSPLTPARLLGPSLTSTTPASSSSGSSSRGPSDTSSRFSKEQRGVAQPLAQLRSCPQEEGPRGRG    351 - 420
LAARPLENRAGGPVARSEEPGAPLPVAVGTAEPGGSMKTTFTIEIKDGRGQASTGRVLLPTGNQRAELTL    421 - 490
GLRAPPTLLSTSSGGKSTITRVNSPGTLARLGSVTHVTSFSHAPPSSRGGCSIKMEAEPAEPLAAAVEAA    491 - 560
NGAEQTRVNKAPEGRSPLSAEELMTIEDEGVLDKMLDQSTDFEERKLIRAALRELRQRKRDQRDKERERR    561 - 630
LQEARGRPGEGRGNTATETTTRHSQRAADGSAVSTVTKTERLVHSNDGTRTARTTTVESSFVRRSENGSG    631 - 700
STMMQTKTFSSSSSSKKMGSIFDREDQASPRAGSLAALEKRQAEKKKELMKAQSLPKTSASQARKAMIEK    701 - 770
LEKEGAAGSPGGPRAAVQRSTSFGVPNANSIKQMLLDWCRAKTRGYEHVDIQNFSSSWSDGMAFCALVHN    771 - 840
FFPEAFDYGQLSPQNRRQNFEVAFSSAEMLVDCVPLVEVDDMMIMGKKPDPKCVFTYVQSLYNHLRRHEL    841 - 910
RLRGKNV                                                                   911 - 917
//

Text Mined References (39)

PMID Year Title
24551305 2014 Smoothelin and caldesmon are reliable markers for distinguishing muscularis propria from desmoplasia: a critical distinction for accurate staging colorectal adenocarcinoma.
24409061 2013 Smoothelin, a new marker to determine the origin of liver fibrogenic cells.
24043717 2014 A study of ?5 chain of collagen IV, caldesmon, placental alkaline phosphatase and smoothelin as immunohistochemical markers of gastrointestinal smooth muscle neoplasms.
23568457 2013 Genetic variants associated with disordered eating.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23121329 2012 Haplotype of smoothelin gene associated with essential hypertension.
23060305 2013 Smoothelin expression in the gastrointestinal tract: implication in colonic inertia.
23033319 2012 Association of the smoothelin (SMTN) gene with cerebral infarction in men: a haplotype-based case-control study.
22963604 2012 A haplotype of the SMTN gene associated with myocardial infarction in Japanese women.
22960022 2012 Association of smooth muscle cell phenotypes with extracellular matrix disorders in thoracic aortic dissection.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21683983 2011 Limited smoothelin expression within the muscularis mucosae: validation in bladder diverticula.
21472682 2011 Expression of smoothelin and smooth muscle actin in the skin.
21164287 2011 Immunohistochemical staining for smoothelin in the duplicated versus the true muscularis mucosae of Barrett esophagus.
20716166 2010 Smoothelin is a specific and robust marker for distinction of muscularis propria and muscularis mucosae in the gastrointestinal tract.
20636795 2010 Smoothelin immunohistochemistry is a useful adjunct for assessing muscularis propria invasion in bladder carcinoma.
20154589 2010 Pitfalls in the use of smoothelin to identify muscularis propria invasion by urothelial carcinoma.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19950405 2009 Smoothelin is a specific marker for smooth muscle neoplasms of the gastrointestinal tract.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19252475 2009 Differential expression of immunohistochemical markers in bladder smooth muscle and myofibroblasts, and the potential utility of desmin, smoothelin, and vimentin in staging of bladder carcinoma.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12176134 2002 Expression of the smoothelin gene is mediated by alternative promoters.
11316948 Identification and characterization of novel smoothelin isoforms in vascular smooth muscle.
10627276 2000 Apparent up-regulation of stimulatory G-protein alpha subunits in the pregnant human myometrium is mimicked by elevated smoothelin expression.
10591208 1999 The DNA sequence of human chromosome 22.
10550614 1999 Smoothelin in adult and developing human arteries and myocardium.
10023782 1999 A novel isoform of the smooth muscle cell differentiation marker smoothelin.
10023778 1999 Differentiating one smooth operator from another.
9847074 1998 Toward a complete human genome sequence.
9244445 1997 Assignment of the human gene for smoothelin (SMTN) to chromosome 22q12 by fluorescence in situ hybridization and radiation hybrid mapping.
9113392 1997 Smoothelin expression characteristics: development of a smooth muscle cell in vitro system and identification of a vascular variant.
8707825 1996 Smoothelin, a novel cytoskeletal protein specific for smooth muscle cells.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.