Property Summary

NCBI Gene PubMed Count 9
PubMed Score 7.35
PubTator Score 2.92

Knowledge Summary


No data available


  Differential Expression (7)

Disease log2 FC p
osteosarcoma 1.194 4.2e-04
medulloblastoma, large-cell 1.400 9.8e-05
intraductal papillary-mucinous neoplasm ... -1.100 3.6e-02
lung adenocarcinoma 1.348 5.1e-05
non-small cell lung carcinoma 1.300 4.5e-17
ulcerative colitis -1.400 3.0e-07
ovarian cancer 1.700 1.6e-11

AA Sequence

DIDAYTTCLYASGTTPVPQLPLLLMALLGLCTLVL                                       421 - 455

Text Mined References (10)

PMID Year Title
26095358 2015 The Lipid-Modifying Enzyme SMPDL3B Negatively Regulates Innate Immunity.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23322567 2013 Identification of a candidate gene for astigmatism.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.