Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -2.200 8.2e-03
oligodendroglioma -1.800 3.3e-02
atypical teratoid / rhabdoid tumor -1.100 3.3e-02
glioblastoma -1.900 6.8e-04
medulloblastoma -1.500 1.3e-02
medulloblastoma, large-cell -1.800 1.3e-02
pediatric high grade glioma -1.300 6.4e-03
pilocytic astrocytoma -1.800 7.0e-05
posterior fossa group B ependymoma 1.200 5.3e-03
invasive ductal carcinoma 1.200 3.9e-02

AA Sequence

MPAKGKKGKGQGKSHGKKQKKPEVDILSPAAMLNLYYIAHNVADCLHLRGFHWPGAPKGKKGRSK           1 - 65
//

Text Mined References (2)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.