Property Summary

NCBI Gene PubMed Count 6
PubMed Score 91.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.700 2.7e-04
atypical teratoid / rhabdoid tumor -1.800 1.6e-07
ependymoma 1.100 1.0e-02
glioblastoma -1.200 1.3e-05
lung cancer 1.200 1.5e-03
medulloblastoma, large-cell -1.400 8.2e-05
oligodendroglioma 1.100 1.2e-02
osteosarcoma -1.053 4.6e-03
psoriasis -1.200 1.5e-03

AA Sequence

MSSAPEPPTFKKEPPKEKEFQSPGLRGVRTTTLFRAVNPELFIKPNKPVMAFGLVTLSLCVAYIGYLHAI      1 - 70
QENKKDLYEAIDSEGHSYMRRKTSKWD                                                71 - 97
//

Text Mined References (8)

PMID Year Title