Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.07
PubTator Score 0.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 1.7e-03
non primary Sjogren syndrome sicca 1.200 2.3e-02
osteosarcoma -2.026 4.3e-05
ovarian cancer -1.100 8.1e-04
pancreatic ductal adenocarcinoma liver m... -1.615 3.1e-02
psoriasis -1.600 1.3e-09
ulcerative colitis -1.200 5.9e-04

Synonym

Accession Q9BQ49 A8MX44
Symbols C19orf42

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MIGDILLFGTLLMNAGAVLNFKLKKKDTQGFGEESREPSTGDNIREFLLSLRYFRIFIALWNIFMMFCMI      1 - 70
VLFGS                                                                      71 - 75
//

Text Mined References (5)

PMID Year Title