Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.08
PubTator Score 0.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
diabetes mellitus 1.200 1.5e-03
ependymoma 1.600 5.8e-08
interstitial cystitis -1.200 2.2e-04
intraductal papillary-mucinous adenoma (... 1.100 1.1e-03
intraductal papillary-mucinous neoplasm ... 1.400 9.6e-03
nasopharyngeal carcinoma -1.400 1.6e-09
osteosarcoma -3.441 7.0e-06
pancreatic cancer 1.100 5.4e-04
pancreatic carcinoma 1.100 5.4e-04

AA Sequence

MAATDFVQEMRAVGERLLLKLQRLPQAEPVEIVAFSVIILFTATVLLLLLIACSCCCTHCCCPERRGRKV      1 - 70
QVQPTPP                                                                    71 - 77
//

Text Mined References (5)

PMID Year Title