Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.016 1.3e-03
group 3 medulloblastoma 1.200 1.3e-02
non primary Sjogren syndrome sicca 1.100 2.0e-02
subependymal giant cell astrocytoma 1.466 1.4e-02
acute myeloid leukemia -1.400 2.1e-03

Synonym

Accession Q8WVI0
Symbols C3orf78

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MFTRAQVRRILQRVPGKQRFGIYRFLPFFFVLGGTMEWIMIKVRVGQETFYDVYRRKASERQYQRRLEDE      1 - 70
//

Text Mined References (7)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
21269460 2011 Initial characterization of the human central proteome.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.