Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
acute myeloid leukemia -1.400 2.1e-03
group 3 medulloblastoma 1.200 1.3e-02
non primary Sjogren syndrome sicca 1.100 2.0e-02
osteosarcoma -1.016 1.3e-03
subependymal giant cell astrocytoma 1.466 1.4e-02

AA Sequence

MFTRAQVRRILQRVPGKQRFGIYRFLPFFFVLGGTMEWIMIKVRVGQETFYDVYRRKASERQYQRRLEDE      1 - 70
//

Text Mined References (7)

PMID Year Title