Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Amyotrophic lateral sclerosis 451 0.0 1.1

Expression

Synonym

Accession Q9BVW6 Q5SZS7
Symbols C13orf44

Gene

  Ortholog (1)

Species Source Disease
Inparanoid OMA EggNOG

AA Sequence

MEAGERIDASQLPHRVLETRGHAISILFGFWTSFICDTYIVLAWISKIKGSPDVSASSDEPYARIQQSRR      1 - 70
QCHAEEDQSQVPEAG                                                            71 - 85
//

Text Mined References (4)

PMID Year Title