Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 2.5e-06
posterior fossa group B ependymoma 416 4.3e-06
cystic fibrosis 1696 9.5e-05
Disease Target Count Z-score Confidence
Follicular adenoma 7 3.69 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
cystic fibrosis -1.100 9.5e-05
ovarian cancer -2.100 2.5e-06
posterior fossa group B ependymoma 1.100 4.3e-06

AA Sequence

MAGGYGVMGDDGSIDYTVHEAWNEATNVYLIVILVSFGLFMYAKRNKRRIMRIFSVPPTEETLSEPNFYD      1 - 70
TISKIRLRQQLEMYSISRKYDYQQPQNQADSVQLSLE                                      71 - 107
//

Text Mined References (7)

PMID Year Title