Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.200 2.2e-02
ependymoma -1.800 2.7e-02
glioblastoma -2.100 6.4e-06
medulloblastoma -1.600 6.9e-08
atypical teratoid / rhabdoid tumor -2.200 2.6e-08
medulloblastoma, large-cell -2.400 4.1e-06
primitive neuroectodermal tumor -1.100 2.2e-03
pancreatic ductal adenocarcinoma liver m... -1.960 2.9e-03
pediatric high grade glioma -1.700 7.2e-07
subependymal giant cell astrocytoma -2.084 3.0e-02
ovarian cancer 2.000 4.7e-04
pancreatic cancer 1.200 6.3e-03

AA Sequence

MWHSVGLTLLVFVATLLIVLLLMVCGWYFVWHLFLSKFKFLRELVGDTGSQEGDHEPSGSETEEDTSSSP      1 - 70
HRIRSARQRRAPADEGHRPLT                                                      71 - 91
//

Text Mined References (4)

PMID Year Title
25130324 2014 A genome-wide search for quantitative trait loci affecting the cortical surface area and thickness of Heschl's gyrus.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.