Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.04
PubTator Score 0.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Down syndrome 499 3.232 1.6

Expression

Gene RIF (1)

AA Sequence

MNWKVLEHVPLLLYILAAKTLILCLTFAGVKMYQRKRLEAKQQKLEAERKKQSEKKDN                  1 - 58
//

Text Mined References (8)

PMID Year Title