Property Summary

NCBI Gene PubMed Count 13
PubMed Score 66.82
PubTator Score 4.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
HEART AND BRAIN MALFORMATION SYNDROME 1 0.0 0.0
Disease Target Count P-value
tuberculosis and treatment for 6 months 409 1.6e-06
Disease Target Count Z-score Confidence
Microsporidiosis 13 4.046 2.0
X-linked dystonia-parkinsonism 9 3.682 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
tuberculosis and treatment for 6 months -1.300 1.6e-06

Protein-protein Interaction (2)

Gene RIF (2)

AA Sequence

MSESGHSQPGLYGIERRRRWKEPGSGGPQNLSGPGGRERDYIAPWERERRDASEETSTSVMQKTPIILSK      1 - 70
PPAERSKQPPPPTAPAAPPAPAPLEKPIVLMKPREEGKGPVAVTGASTPEGTAPPPPAAPAPPKGEKEGQ     71 - 140
RPTQPVYQIQNRGMGTAAPAAMDPVVGQAKLLPPERMKHSIKLVDDQMNWCDSAIEYLLDQTDVLVVGVL    141 - 210
GLQGTGKSMVMSLLSANTPEEDQRTYVFRAQSAEMKERGGNQTSGIDFFITQERIVFLDTQPILSPSILD    211 - 280
HLINNDRKLPPEYNLPHTYVEMQSLQIAAFLFTVCHVVIVVQDWFTDLSLYRFLQTAEMVKPSTPSPSHE    281 - 350
SSSSSGSDEGTEYYPHLVFLQNKARREDFCPRKLRQMHLMIDQLMAHSHLRYKGTLSMLQCNVFPGLPPD    351 - 420
FLDSEVNLFLVPFMDSEAESENPPRAGPGSSPLFSLLPGYRGHPSFQSLVSKLRSQVMSMARPQLSHTIL    421 - 490
TEKNWFHYAARIWDGVRKSSALAEYSRLLA                                            491 - 520
//

Text Mined References (25)

PMID Year Title