Property Summary

NCBI Gene PubMed Count 11
PubMed Score 39.42
PubTator Score 59.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Gene RIF (5)

AA Sequence

MASGAARWLVLAPVRSGALRSGPSLRKDGDVSAAWSGSGRSLVPSRSVIVTRSGAILPKPVKMSFGLLRV      1 - 70
FSIVIPFLYVGTLISKNFAALLEEHDIFVPEDDDDDD                                      71 - 107
//

Text Mined References (15)

PMID Year Title