Property Summary

NCBI Gene PubMed Count 11
PubMed Score 38.41
PubTator Score 59.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Gene RIF (4)

PMID Text
26489515 Our experiments provide novel details about how MCU/EMRE is regulated by MICU1 and an original approach to investigate MCU/EMRE activation in intact cells.
24231807 EMRE is essential for in vivo uniporter current and additionally bridges the calcium-sensing role of MICU1 and MICU2 with the calcium-conducting role of MCU.
24231807 EMRE (C22orf32) is an integral mitochondrial inner membrane protein and component of the mitochondrial uniporter complex (uniplex). It is essential for uniporter channel activity. In its absence, the pore does not interact with its regulators MICU1/2.
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MASGAARWLVLAPVRSGALRSGPSLRKDGDVSAAWSGSGRSLVPSRSVIVTRSGAILPKPVKMSFGLLRV      1 - 70
FSIVIPFLYVGTLISKNFAALLEEHDIFVPEDDDDDD                                      71 - 107
//

Text Mined References (16)

PMID Year Title
27642048 2016 The m-AAA Protease Associated with Neurodegeneration Limits MCU Activity in Mitochondria.
27184846 2016 MCUR1 Is a Scaffold Factor for the MCU Complex Function and Promotes Mitochondrial Bioenergetics.
27099988 2016 Dual functions of a small regulatory subunit in the mitochondrial calcium uniporter complex.
26774479 2016 EMRE Is a Matrix Ca(2+) Sensor that Governs Gatekeeping of the Mitochondrial Ca(2+) Uniporter.
26489515 2015 Rearrangement of MICU1 multimers for activation of MCU is solely controlled by cytosolic Ca(2.).
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24231807 2013 EMRE is an essential component of the mitochondrial calcium uniporter complex.
22925203 2012 Inactivation of Pde8b enhances memory, motor performance, and protects against age-induced motor coordination decay.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12529303 2003 Reevaluating human gene annotation: a second-generation analysis of chromosome 22.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.