Property Summary

NCBI Gene PubMed Count 15
PubMed Score 92.75
PubTator Score 4.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis -1.600 3.3e-03
medulloblastoma, large-cell 1.600 9.3e-05
diabetes mellitus 1.200 1.1e-03
adult high grade glioma 1.100 3.6e-03
ovarian cancer 1.500 7.4e-12

Synonym

Accession P49901 Q96A42
Symbols MCS
MCSP
HSMCSGEN1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
24244262 the initiation results indicate that an ectopically expressed variant form of SMCP has a role in tumor initiation of CSCs/CICs and that the variant form of SMCP might be a novel CSC/CIC marker
16325371 The levels of SMCP mRNA in human are much lower than in other mammals.

AA Sequence

MCDQTKHSKCCPAKGNQCCPPQQNQCCQSKGNQCCPPKQNQCCQPKGSQCCPPKHNHCCQPKPPCCIQAR      1 - 70
CCGLETKPEVSPLNMESEPNSPQTQDKGCQTQQQPHSPQNESRPSK                             71 - 116
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24244262 2013 Ectopically expressed variant form of sperm mitochondria-associated cysteine-rich protein augments tumorigenicity of the stem cell population of lung adenocarcinoma cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17047026 2006 Non-invasive genetic diagnosis of male infertility using spermatozoal RNA: KLHL10 mutations in oligozoospermic patients impair homodimerization.
16325371 2006 Comparative genomics of the sperm mitochondria-associated cysteine-rich protein gene.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11940662 2002 Asthenozoospermia in mice with targeted deletion of the sperm mitochondrion-associated cysteine-rich protein (Smcp) gene.
11375445 2001 Mammalian selenium-containing proteins.
10411523 1999 Sperm mitochondria-associated cysteine-rich protein (SMCP) is an autoantigen in Lewis rats.
8916043 1996 Developmental expression, intracellular localization, and selenium content of the cysteine-rich protein associated with the mitochondrial capsules of mouse sperm.
8833144 1996 Isolation, expression, and chromosomal localization of the human mitochondrial capsule selenoprotein gene (MCSP).
2715306 1989 Semen selenium content and sperm mitochondrial volume in human and some animal species.
1418626 1992 Sequence of the gene encoding the mitochondrial capsule selenoprotein of mouse sperm: identification of three in-phase TGA selenocysteine codons.