Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6685 8.5e-11
non diabetic and post-ischemic heart failure 200 4.5e-02

Expression

  Differential Expression (2)

Disease log2 FC p
non diabetic and post-ischemic heart fai... 1.300 4.5e-02
psoriasis 1.600 8.5e-11

Synonym

Accession Q147U7 B3KW20
Symbols C3orf43

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MNNETTTLISLKEAMKRVDHKLQALETQFKELDFTKDNLMQKFEHHSKALASQAAQDEMWTAVRALQLTS      1 - 70
MELNILYSYVIEVLICLHTRVLEKLPDLVRGLPTLASVLRRKVKNKRVRVVWESILEECGLQEGDITALC     71 - 140
TFFIARGNKAEHYTAKVRQMYIRDVTFLITNMVKNQALQDSLLRAVQVIEKGKAVRTPEKQKSSLEELIP    141 - 210
SVKN                                                                      211 - 214
//

Text Mined References (4)

PMID Year Title
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.