Property Summary

NCBI Gene PubMed Count 26
PubMed Score 23.25
PubTator Score 21.00

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

PMID Text
26491021 analysis of functional differences of SMC2 and SMC4 hinge domain between condensins and cohesin in DNA recognition
25422241 Knockdown of SMC-4 expression significantly suppressed the proliferation.
25081869 Results indicate that miR-124-5p may target the tumorigenesis gene, SMC4, which suggests that expression levels of miR-124-5p in plasma and FFPE samples.
22842912 SMC4 expression was significantly associated with tumor size, de-differentiation, advanced stages and vascular invasion of the primary liver cancers.
20800603 Observational study of gene-disease association. (HuGE Navigator)
19454010 Interaction of HIV-1 Tat with SMC4 in T-cells is identified by a proteomic strategy based on affinity chromatography coupled with mass spectrometry
17488335 mutation analysis of hCAP-C & hCAP-E in leukemia-lymphoma cell lines including 8 pyothorax-associated lymphoma (PAL); 3 of 8 PAL cell lines have hCAP-C or hCAP-E heterozygous mutations, indicating condensin mutations are relatively frequent in PAL

AA Sequence

MPRKGTQPSTARRREEGPPPPSPDGASSDAEPEPPSGRTESPATAAETASEELDNRSLEEILNSIPPPPP      1 - 70
PAMTNEAGAPRLMITHIVNQNFKSYAGEKILGPFHKRFSCIIGPNGSGKSNVIDSMLFVFGYRAQKIRSK     71 - 140
KLSVLIHNSDEHKDIQSCTVEVHFQKIIDKEGDDYEVIPNSNFYVSRTACRDNTSVYHISGKKKTFKDVG    141 - 210
NLLRSHGIDLDHNRFLILQGEVEQIAMMKPKGQTEHDEGMLEYLEDIIGCGRLNEPIKVLCRRVEILNEH    211 - 280
RGEKLNRVKMVEKEKDALEGEKNIAIEFLTLENEIFRKKNHVCQYYIYELQKRIAEMETQKEKIHEDTKE    281 - 350
INEKSNILSNEMKAKNKDVKDTEKKLNKITKFIEENKEKFTQLDLEDVQVREKLKHATSKAKKLEKQLQK    351 - 420
DKEKVEEFKSIPAKSNNIINETTTRNNALEKEKEKEEKKLKEVMDSLKQETQGLQKEKESREKELMGFSK    421 - 490
SVNEARSKMDVAQSELDIYLSRHNTAVSQLTKAKEALIAASETLKERKAAIRDIEGKLPQTEQELKEKEK    491 - 560
ELQKLTQEETNFKSLVHDLFQKVEEAKSSLAMNRSRGKVLDAIIQEKKSGRIPGIYGRLGDLGAIDEKYD    561 - 630
VAISSCCHALDYIVVDSIDIAQECVNFLKRQNIGVATFIGLDKMAVWAKKMTEIQTPENTPRLFDLVKVK    631 - 700
DEKIRQAFYFALRDTLVADNLDQATRVAYQKDRRWRVVTLQGQIIEQSGTMTGGGSKVMKGRMGSSLVIE    701 - 770
ISEEEVNKMESQLQNDSKKAMQIQEQKVQLEERVVKLRHSEREMRNTLEKFTASIQRLIEQEEYLNVQVK    771 - 840
ELEANVLATAPDKKKQKLLEENVSAFKTEYDAVAEKAGKVEAEVKRLHNTIVEINNHKLKAQQDKLDKIN    841 - 910
KQLDECASAITKAQVAIKTADRNLQKAQDSVLRTEKEIKDTEKEVDDLTAELKSLEDKAAEVVKNTNAAE    911 - 980
ESLPEIQKEHRNLLQELKVIQENEHALQKDALSIKLKLEQIDGHIAEHNSKIKYWHKEISKISLHPIEDN    981 - 1050
PIEEISVLSPEDLEAIKNPDSITNQIALLEARCHEMKPNLGAIAEYKKKEELYLQRVAELDKITYERDSF   1051 - 1120
RQAYEDLRKQRLNEFMAGFYIITNKLKENYQMLTLGGDAELELVDSLDPFSEGIMFSVRPPKKSWKKIFN   1121 - 1190
LSGGEKTLSSLALVFALHHYKPTPLYFMDEIDAALDFKNVSIVAFYIYEQTKNAQFIIISLRNNMFEISD   1191 - 1260
RLIGIYKTYNITKSVAVNPKEIASKGLC                                             1261 - 1288
//

Text Mined References (40)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26491021 2015 Structural Basis for Dimer Formation of Human Condensin Structural Maintenance of Chromosome Proteins and Its Implications for Single-stranded DNA Recognition.
25422241 2014 Structural maintenance of chromosomes 4 is a predictor of survival and a novel therapeutic target in colorectal cancer.
25081869 2014 Low expression levels of microRNA-124-5p correlated with poor prognosis in colorectal cancer via targeting of SMC4.
24980149 2014 A novel miR-219-SMC4-JAK2/Stat3 regulatory pathway in human hepatocellular carcinoma.
23884423 2013 Ribosomal RNA gene transcription mediated by the master genome regulator protein CCCTC-binding factor (CTCF) is negatively regulated by the condensin complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22842912 2012 Overexpression of the structural maintenance of chromosome 4 protein is associated with tumor de-differentiation, advanced stage and vascular invasion of primary liver cancer.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21150319 2010 Proteomic profiling of Myc-associated proteins.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17488335 2007 Condensin mutations and abnormal chromosomal structures in pyothorax-associated lymphoma.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17314511 2007 Large-scale identification of c-MYC-associated proteins using a combined TAP/MudPIT approach.
17268547 2007 Reconstitution and subunit geometry of human condensin complexes.
17113138 2006 Wapl controls the dynamic association of cohesin with chromatin.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11850403 2002 The ABCs of SMC proteins: two-armed ATPases for chromosome condensation, cohesion, and repair.
11321372 2001 The structural maintenance of chromosomes (SMC) family of proteins in mammals.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11136719 2001 Chromosome condensation by a human condensin complex in Xenopus egg extracts.
10958694 2000 A human condensin complex containing hCAP-C-hCAP-E and CNAP1, a homolog of Xenopus XCAP-D2, colocalizes with phosphorylated histone H3 during the early stage of mitotic chromosome condensation.
10319587 1999 Isolation and characterization of a human cDNA homologous to the Xenopus laevis XCAP-C gene belonging to the structural maintenance of chromosomes (SMC) family.
9789013 1998 Identification of two distinct human SMC protein complexes involved in mitotic chromosome dynamics.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.