Property Summary

NCBI Gene PubMed Count 49
PubMed Score 63.09
PubTator Score 30.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Rheumatoid Arthritis 2.700 5.5e-06
oligodendroglioma 1.200 3.1e-02
osteosarcoma 1.785 7.2e-07
glioblastoma 2.100 7.7e-06
sonic hedgehog group medulloblastoma 2.400 3.5e-10
astrocytoma 1.300 2.4e-02
atypical teratoid / rhabdoid tumor 2.300 8.9e-09
medulloblastoma, large-cell 3.200 1.2e-07
primitive neuroectodermal tumor 2.000 3.0e-05
lung cancer 2.600 2.6e-06
colon cancer 1.100 1.4e-03
diabetes mellitus -1.200 9.0e-03
pediatric high grade glioma 1.600 1.3e-05
lung adenocarcinoma 1.433 1.2e-05
ovarian cancer 1.600 4.5e-05

Protein-protein Interaction (1)

Gene RIF (14)

PMID Text
24434208 we identify BAF155 as a substrate for arginine methyltransferase CARM1.
24365151 Wwp2 acts as a ubiquitin ligase of SRG3.
23996527 Results show the secondary structure of SWIRM domain of BAF155 consists of five alpha-helices forming a typical histone fold for DNA interactions.
23799850 miR-320c regulates the resistance of pancreatic cancer cells to gemcitabine through SMARCC1.
22139574 loss of BAF155 expression represents another mechanism for inactivation of SWI/SNF complex activity in the development in human cancer.
21699904 HIV-1 Tat induces phosphorylation of BRG1 and BAF155
20829358 Data show that the mechanism of BAF155-mediated stabilization of BAF57 involves blocking its ubiquitination by preventing interaction with TRIP12.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19367581 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19156145 patients with tumours displaying high levels of CBFB and SMARCC1 proteins had a significantly better overall survival rate than patients with low levels
18581278 An increased expression of SMARCC1 protein was found in prostate cancer positively correlated with tumour dedifferentiation, progression, metastasis and time to recurrence.
17513758 Constitutive expression of SRG3 inhibits positive selection processes in T-cell receptor transgenic mice.
16568092 BAF155 and potentially INI1 are substrates for Akt phosphorylation
16199878 protein levels of BAF155/170 dictate the maximum cellular amount of BAF57

AA Sequence

MAAAAGGGGPGTAVGATGSGIAAAAAGLAVYRRKDGGPATKFWESPETVSQLDSVRVWLGKHYKKYVHAD      1 - 70
APTNKTLAGLVVQLLQFQEDAFGKHVTNPAFTKLPAKCFMDFKAGGALCHILGAAYKYKNEQGWRRFDLQ     71 - 140
NPSRMDRNVEMFMNIEKTLVQNNCLTRPNIYLIPDIDLKLANKLKDIIKRHQGTFTDEKSKASHHIYPYS    141 - 210
SSQDDEEWLRPVMRKEKQVLVHWGFYPDSYDTWVHSNDVDAEIEDPPIPEKPWKVHVKWILDTDIFNEWM    211 - 280
NEEDYEVDENRKPVSFRQRISTKNEEPVRSPERRDRKASANARKRKHSPSPPPPTPTESRKKSGKKGQAS    281 - 350
LYGKRRSQKEEDEQEDLTKDMEDPTPVPNIEEVVLPKNVNLKKDSENTPVKGGTVADLDEQDEETVTAGG    351 - 420
KEDEDPAKGDQSRSVDLGEDNVTEQTNHIIIPSYASWFDYNCIHVIERRALPEFFNGKNKSKTPEIYLAY    421 - 490
RNFMIDTYRLNPQEYLTSTACRRNLTGDVCAVMRVHAFLEQWGLVNYQVDPESRPMAMGPPPTPHFNVLA    491 - 560
DTPSGLVPLHLRSPQVPAAQQMLNFPEKNKEKPVDLQNFGLRTDIYSKKTLAKSKGASAGREWTEQETLL    561 - 630
LLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLENSDASLGPLAYQPVPFSQSGNPVMSTVA    631 - 700
FLASVVDPRVASAAAKAALEEFSRVREEVPLELVEAHVKKVQEAARASGKVDPTYGLESSCIAGTGPDEP    701 - 770
EKLEGAEEEKMEADPDGQQPEKAENKVENETDEGDKAQDGENEKNSEKEQDSEVSEDTKSEEKETEENKE    771 - 840
LTDTCKERESDTGKKKVEHEISEGNVATAAAAALASAATKAKHLAAVEERKIKSLVALLVETQMKKLEIK    841 - 910
LRHFEELETIMDREKEALEQQRQQLLTERQNFHMEQLKYAELRARQQMEQQQHGQNPQQAHQHSGGPGLA    911 - 980
PLGAAGHPGMMPHQQPPPYPLMHHQMPPPHPPQPGQIPGPGSMMPGQHMPGRMIPTVAANIHPSGSGPTP    981 - 1050
PGMPPMPGNILGPRVPLTAPNGMYPPPPQQQPPPPPPADGVPPPPAPGPPASAAP                  1051 - 1105
//

Text Mined References (62)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24434208 2014 CARM1 methylates chromatin remodeling factor BAF155 to enhance tumor progression and metastasis.
24421395 2014 Residual complexes containing SMARCA2 (BRM) underlie the oncogenic drive of SMARCA4 (BRG1) mutation.
24365151 2014 Wwp2 targets SRG3, a scaffold protein of the SWI/SNF-like BAF complex, for ubiquitination and degradation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23996527 2013 1H, 15N, and 13C resonance assignments and secondary structure of the SWIRM domain of human BAF155, a chromatin remodeling complex component.
23799850 2013 miR-320c regulates gemcitabine-resistance in pancreatic cancer via SMARCC1.
23540691 2013 Reversible disruption of mSWI/SNF (BAF) complexes by the SS18-SSX oncogenic fusion in synovial sarcoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22139574 2011 Identification of a core member of the SWI/SNF complex, BAF155/SMARCC1, as a human tumor suppressor gene.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20829358 2010 Ubiquitin-dependent and ubiquitin-independent control of subunit stoichiometry in the SWI/SNF complex.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20111005 2010 Crosstalk between C/EBPbeta phosphorylation, arginine methylation, and SWI/SNF/Mediator implies an indexing transcription factor code.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19367581 2010 Identification of neuroglycan C and interacting partners as potential susceptibility genes for schizophrenia in a Southern Chinese population.
19156145 2009 Dysregulation of the transcription factors SOX4, CBFB and SMARCC1 correlates with outcome of colorectal cancer.
18765789 2008 Regulation of muscle development by DPF3, a novel histone acetylation and methylation reader of the BAF chromatin remodeling complex.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18581278 2008 SMARCC1 expression is upregulated in prostate cancer and positively correlated with tumour recurrence and dedifferentiation.
18303029 2008 BAF60a interacts with p53 to recruit the SWI/SNF complex.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17513758 2007 Down-regulation of the SWI/SNF chromatin remodeling activity by TCR signaling is required for proper thymocyte maturation.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17314511 2007 Large-scale identification of c-MYC-associated proteins using a combined TAP/MudPIT approach.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16568092 2006 Members of the hSWI/SNF chromatin remodeling complex associate with and are phosphorylated by protein kinase B/Akt.
16217013 2005 Heterogeneous nuclear ribonucleoprotein C1/C2, MeCP1, and SWI/SNF form a chromatin remodeling complex at the beta-globin locus control region.
16199878 2005 Regulating SWI/SNF subunit levels via protein-protein interactions and proteasomal degradation: BAF155 and BAF170 limit expression of BAF57.
16083285 Global phosphoproteome of HT-29 human colon adenocarcinoma cells.
15985610 2005 PBAF chromatin-remodeling complex requires a novel specificity subunit, BAF200, to regulate expression of selective interferon-responsive genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
12917342 2003 BAF60a mediates critical interactions between nuclear receptors and the BRG1 chromatin-remodeling complex for transactivation.
12665591 2003 Novel SWI/SNF chromatin-remodeling complexes contain a mixed-lineage leukemia chromosomal translocation partner.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12368262 2002 Identification of a polymorphic, neuron-specific chromatin remodeling complex.
11734557 2002 SYT associates with human SNF/SWI complexes and the C-terminal region of its fusion partner SSX1 targets histones.
11726552 2001 Fanconi anemia protein, FANCA, associates with BRG1, a component of the human SWI/SNF complex.
11238380 2001 Purification and characterization of mSin3A-containing Brg1 and hBrm chromatin remodeling complexes.
11078522 2000 The human SWI/SNF-B chromatin-remodeling complex is related to yeast rsc and localizes at kinetochores of mitotic chromosomes.
11018012 2000 Functional selectivity of recombinant mammalian SWI/SNF subunits.
10619021 1999 A C/EBP beta isoform recruits the SWI/SNF complex to activate myeloid genes.
10078207 1999 Reconstitution of a core chromatin remodeling complex from SWI/SNF subunits.
9891079 1999 Cyclin E associates with BAF155 and BRG1, components of the mammalian SWI-SNF complex, and alters the ability of BRG1 to induce growth arrest.
9744861 1998 Mitotic inactivation of a human SWI/SNF chromatin remodeling complex.
9710619 1998 A human RNA polymerase II complex containing factors that modify chromatin structure.
9693044 1998 Five SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin (SMARC) genes are dispersed in the human genome.
9590696 1998 Chromatin remodelling by the glucocorticoid receptor requires the BRG1 complex.
8895581 1996 Purification and biochemical heterogeneity of the mammalian SWI-SNF complex.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8804307 1996 Diversity and specialization of mammalian SWI/SNF complexes.