Property Summary

NCBI Gene PubMed Count 218
PubMed Score 563.41
PubTator Score 543.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 1.500 4.0e-06
ependymoma 1.100 7.5e-03
oligodendroglioma 1.200 2.5e-03
psoriasis -1.900 7.6e-05
osteosarcoma 2.347 1.7e-08
medulloblastoma 1.400 4.8e-07
medulloblastoma, large-cell 1.100 2.0e-04
lung cancer 1.500 1.1e-03
atypical teratoid/rhabdoid tumor -1.300 5.6e-04
ovarian cancer -1.100 3.3e-05

 GWAS Trait (1)

Gene RIF (202)

PMID Text
26520417 Reduced expression of SMARCB1 immunoreactivity was found to be highly sensitive and specific for synovial sarcoma.
26364901 Missense mutation in SMARCB1 gene is associated with Coffin-Siris phenotype, and schwannomatosis.
26350979 Macaca mulatta SMARCB1 showed 23 single nucleotide differences compared to the human ortholog and the amino acid sequence is 100% conserved between human and simian INI1.
26342709 study describes a rare case of a novel nonsense mutation in SMARCB1 that causes schwannomatosis; first report of a SMARCB1 mutation in a schwannomatosis family exhibiting (unilateral) vestibular schwannoma; results constitute a significant finding given that SMARCB1 mutations can cause both conditions via a four-hit mechanism
26342593 we report on a new Italian family with recurrence of SMARCB1 germ-line deletion in two siblings due to gonadal mosaicism
26261664 Case Report: SMARCB1-deficient vulvar sarcoma expressing ERG and FLI1.
26171919 Myoepithelioma-like tumors of the vulvar region deficient in SMARCB1 constitute a distinct group of tumors.
26109171 a novel INI1(+) ATRT-like subtype among Taiwanese pediatric patients
26073604 Mutations in INI1 that cause schwannomatosis target a hitherto unidentified N-terminal winged helix DNA binding domain that is also present in the BAF45a/PHF10 subunit of the SWI/SNF complex.
25754356 Identification of SMARCB1 mutations adds to the growing literature regarding the role of epigenetic control mechanisms in melanoma progression and therapeutic resistance.
25731772 Most of the components of the SWI2/SNF2 chromatin remodeling complex (BRG1/BRM, BAF250, BAF180, BAF170, BAF155, BAF60a, BAF53A, actin and InI1) except BRM, BAF155 and BAF57, are identified to interact with HIV-1 Tat in Jurkat cell
25663425 SMARCB1 loss in ascites cells is associated with abdominal rhabdoid tumor.
25651469 We conclude that SMARCB1-deficient vulvar neoplasms chiefly comprise epithelioid sarcoma and myoepithelial carcinoma
25649007 INI1-retained Small cell undifferentiated may be not prognostically unfavorable
25559666 Taken together, these data indicate that Nef is a critical viral protein for incorporating nascent proviral DNA into host chromosomes in resting peripheral mononuclear leukocytes and that this occurs through interaction with INI1.
25559666 Most of the components of the SWI2/SNF2 chromatin remodeling complex (BRG1/BRM, BAF250, BAF180, BAF170, BAF155, BAF60a, BAF53A, actin and InI1) except BRM, BAF155 and BAF57, are identified to interact with HIV-1 Tat in Jurkat cell
25496315 We report, for the first time, co-inactivation and frequent mutations of SMARCB1, SMARCA2 and PBRM1 in MRTs.
25479928 analyzed the frequency of ERG and SALL4 expressions in 80 SMARCB1/INI1-deficient tumors
25271443 our data unravel differential roles for SWI/SNF subunits in muscle differentiation, with BAF47 playing a dual role both in the permanent cell cycle exit and in the regulation of muscle-specific genes.
25246033 This a review of the histopathologic features of malignant rhabdoid tumor (MRT) and the importance and significance of loss of expression of SMARCB1 in both MRT and nonrhabdoid tumors. [Review]
25200863 Of the 23 epithelioid sarcoma cases, 19 showed a loss of PBRM1, and 18 a loss of INI1. In 17 cases, loss of both proteins was observed. The pattern of PBRM1 expression was similar to that of INI1: not correlated with changes in cellular morphology.
25168959 Genotype-phenotype correlation of Coffin-Siris syndrome caused by mutations in SmarCB1 gene.
25103069 in pancreatic undifferentiated rhabdoid carcinomas SMARCB1 loss is restricted to the anaplastic monomorphic subtype
25081545 BAF complex gene SMARCB1 is mutated in Coffin-Siris syndrome patients.
25009291 SNF5 loss dramatically alters SWI/SNF complex composition and prevents formation of complexes required for cellular differentiation.
25007146 Inactivation of the SMARCB1 tumor-suppressor gene appears to be involved in the pathogenesis of a subset of sinonasal carcinomas.
24983247 Mutations in SMARCB1 occurred in areas of chromosomal copy loss in chordoma tumor samples.
24933152 Whereas SMARCB1 alone seems to account for rhabdoid disease, there is likely to be substantial heterogeneity in schwannomatosis even for familial disease.
24853101 this review discusses normal functions of SMARCB1 and the SWI/SNF complex as well as mechanistic and potentially therapeutic insights that have emerged.
24832165 Case Reports: sinonasal carcinoma with loss of nuclear SMARCB1 expression.
24585572 Study confirms the shared pathogenesis of proximal and distal Epithelioid sarcomas, showing consistent SMARCB1 homozygous deletions.
24525513 Case Report: leiomyoma associated with a germline SMARCB1 mutation in schwannomatosis.
24503755 Case Report/Review: loss of SMARCB1 in rhabdoid carcinomas of the gastrointestinal tract is associated with a highly aggressive course.
24418192 Homozygous deletions or gene mutations in CNTNAP2 and SMARCB1 associated with malignant rhabdoid tumors.
24327545 Loss of SMARCB1 protein expression in epithelioid sarcoma is due to the epigenetic mechanism of gene silencing by oncomiRs.
24287458 miR193a-5p may have an important role in the inhibition of SMARCB1 mRNA expression.
24286138 SMARCB1/INI1-dysregulation and genetic hot-spots on the long arm of chromosome 22 might play an important role in the colorectal cancer metastatic behavior.
24285714 these findings define a leukemia maintenance function for SWI/SNF that is linked to enhancer-mediated gene regulation
24204904 Re-expression of SNF5 in MRT cells.
24123847 Loss of SMARCB1 gene is associated with rhabdoid tumors.
24075062 SMARCB1 is a useful tumor marker for differential diagnosis of musculoskeletal tumors.
23904343 The switch/sucrose non-fermenting complex has a tumor-suppressive function, and that switch/sucrose non-fermenting gene deficiencies may affect the properties of cancer cells, which could be of value for the development of novel therapeutic strategies.
23851497 Results indicate that hSNF5 affects both the stability and the activity of DNM2, uncovering an unexpected role of hSNF5 in modulating endocytosis, and open new perspectives in understanding the role of hSNF5 in tumour genesis.
23815551 SMARCB1, SMARCA4, or ARID1B were mutated in 20 out of 49 Coffin-Siris syndrome patients.
23799881 These results demonstrate that a severe defect in HIV-1 integrase-human INI1 interaction is associated with production of defective particles and a subsequent defect in post-entry events.
23799881 Most of the components of the SWI2/SNF2 chromatin remodeling complex (BRG1/BRM, BAF250, BAF180, BAF170, BAF155, BAF60a, BAF53A, actin and InI1) except BRM, BAF155 and BAF57, are identified to interact with HIV-1 Tat in Jurkat cell
23593299 In HIV-1 integration, the integrase binding domain of INI1 inhibits the 3' processing reaction but does not interfere with specific viral DNA binding.
23593299 Most of the components of the SWI2/SNF2 chromatin remodeling complex (BRG1/BRM, BAF250, BAF180, BAF170, BAF155, BAF60a, BAF53A, actin and InI1) except BRM, BAF155 and BAF57, are identified to interact with HIV-1 Tat in Jurkat cell
23576573 These observations provide definitive support to the role of SMARCB1 inactivation in the pathogenesis of epithelioid sarcoma and disclose novel clues to therapeutic approaches tailored to SMARCB1-negative epithelioid sarcoma.
23435428 SNF5 is essential for regulating Wnt/beta-catenin pathway target expression.
23364536 Our studies show that hSNF5 regulates only a subset of p53 target genes, including p21 and NOXA, in MRT cell lines. We also show that hSNF5 reexpression modulates SWI/SNF complex levels at the transcription start site (TSS)
23348212 These data suggest that inactivation of SMARCB1 may play a role in the pathogenesis of renal medullary carcinoma.
23245672 uniformly decreased INI1 immunoreactivity is highly sensitive and specific for synovial sarcoma.
23174932 Loss of SMARCB1 expression in epithelioid sarcoma is caused neither by DNA hypermethylation nor by post-translational modifications. Most likely it is a result of the microRNA destruction of SMARCB1 mRNA.
23074045 Data indicate that in atypical teratoid/rhabdoid tumor (AT/RT), high-resolution genomic analysis by MIP SNP assay confirmed a wide absence of genomic alterations other than SMARCB1.
23060122 Report a high percentage of SMARCB1 alterations in epithelioid sarcoma.
22949514 Data suggest that these tumors develop through a mechanism that is distinct from that of rhabdoid tumors in which SMARCB1 protein is completely absent in tumor cells.
22928108 Most of the components of the SWI2/SNF2 chromatin remodeling complex (BRG1/BRM, BAF250, BAF180, BAF170, BAF155, BAF60a, BAF53A, actin and InI1) except BRM, BAF155 and BAF57, are identified to interact with HIV-1 Tat in Jurkat cell
22797305 Sequenced the exomes of 35 rhabdoid tumors, aggressive cancers characterized by biallelic loss of SMARCB1 of the chromatin remodeling complex. Identified an extremely low rate of mutation, with loss of SMARCB1 being essentially the sole recurrent event.
22752724 SMARCB1 mutations associated with familial schwannomatosis with meningiomas
22698742 Both BEX2 and INI1/hSNF5 mainly localized in cell nucleus.
22686875 neoplastic cells showed complete loss of SMARCB1/INI1 expression in all six cases of Renal medullary carcinoma
22672440 This immunohistochemistry was used to identify whether loss of INI1 protein expression occurred in the central nervous system primitive neuroectodermal tumors and pineoblastomas
22614000 SMARCB1 inactivation, occasionally associated with NF2 deletion, might have oncogenic effects in peripheral nerves.
22544318 SNF5 recruits the SWI/SNF complex to the BIN1 promoter, and that the marked reduction of BIN1 expression in RT correlates with decreased SWI/SNF occupancy.
22490415 INI1 plays a key role in gastric carcinogenesis by affecting proliferation, apoptosis and invasion.
22479537 chromatin remodeling factor SMARCB1 forms a complex with human cytomegalovirus proteins UL114 and UL44
22434358 SMARCB1 mutations are found in a significant proportion of schwannomatosis patients.
22082606 We report the presence of a novel germline mutation in the SMARCB1/INI1 gene in a patient with multiple schwannomas and in 3 of her children, 2 of whom were diagnosed with atypical teratoid/rhabdoid tumors of the brain.
22038540 Data suggest that the SMARCB1 exon 2 missense mutation in this family predisposes to the development of meningiomas as well as schwannomas, and that this mutation preferentially induces cranial meningiomas located at the falx cerebri.
22020042 This study reveals that a novel yet unidentified posttranscriptional regulatory mechanism(s) for INI1 protein synthesis exists in Atypical teratoid/rhabdoid tumor tumor cells.
21994574 Most of the components of the SWI2/SNF2 chromatin remodeling complex (BRG1/BRM, BAF250, BAF180, BAF170, BAF155, BAF60a, BAF53A, actin and InI1) except BRM, BAF155 and BAF57, are identified to interact with HIV-1 Tat in Jurkat cell
21809989 Immunohistochemical reactivity for BAF47 is clinically useful in distinguishing medullo-blastomas from atypical teratoid/rhabdoid tumors.
21705046 Our results suggest that some CDC cases might be associated with genetic alterations involving the SMARCB1/INI1 gene
21637919 RB1CC1 essentially requires binding with hSNF5 to activate the p16 promoter.
21613800 The hemiallelic loss of INI1 gene causing reduced expression of INI1 protein probably does not have a major impact in the progression of GIST.
21521802 These results indicated that Aurora A is a direct downstream target of INI1/hSNF5-mediated repression in RT cells and that loss of INI1/hSNF5 leads to aberrant overexpression of Aurora A in these tumors, which is required for their survival.
21494030 genetic association studies: Results suggest that alterations of the SNF5 gene are rare in hematological neoplasms with chromosome 22 abnormalities.
21347347 Most of the components of the SWI2/SNF2 chromatin remodeling complex (BRG1/BRM, BAF250, BAF180, BAF170, BAF155, BAF60a, BAF53A, actin and InI1) except BRM, BAF155 and BAF57, are identified to interact with HIV-1 Tat in Jurkat cell
21255467 results suggest that patients with schwannomas have a significant probability of carrying a SMARCB1 mutation.
21240060 Loss of INI1 immunohistochemical expression in glioblastoma may be indicating an underlying molecular aberration accounting for the more aggressive clinical behaviour.
21208904 The results show a high proportion of hSNF5/INI1 germline mutations in patients with RT that can be found at any age and up to 60% in the youngest patients.
21159874 hSNF5 negative mutant S6 inhibited the early stages of HIV-1 assembly.
21159874 Most of the components of the SWI2/SNF2 chromatin remodeling complex (BRG1/BRM, BAF250, BAF180, BAF170, BAF155, BAF60a, BAF53A, actin and InI1) except BRM, BAF155 and BAF57, are identified to interact with HIV-1 Tat in Jurkat cell
21159066 [review] Chromosome 22 mutation of SNF/INI1 causes its protein product to participate in the chromatin remodeling mechanism of this highly malignant atypical teratoid/rhabdoid tumor.
21127945 loss of INI1 could induce the chromosomal instability that might be responsible for the genesis of teratoid/rhabdoid tumor.
21108436 Approximately one-third of newly diagnosed patients with rhabdoid tumor have an underlying genetic predisposition to tumors due to a germline SMARCB1 alteration. Families may demonstrate incomplete penetrance and gonadal mosaicism
21057957 A likely role is revealed for SMARCB1/INI1 in a subset of chordomas with aggressive features.
20932739 Observational study of gene-disease association. (HuGE Navigator)
20930055 A germline missense mutation in exon 2 of SMARCB1 predisposes to multiple meningiomas and a four-hit mechanism of tumour suppressor gene inactivation, involving SMARCB1 and NF2, might be operative in familial multiple meningiomas associated meningiomas.
20829602 These results suggest that the SWI/SNF complex is involved in human papillomavirus E2-driven transcription and DNA replication via interaction with E2.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20506188 The interaction of RUNX1 with the SWI/SNF BRG1 and INI1 to control hematopoietic-specific gene expression is described.
20472658 SMARCB1 is not a major contributor to multiple meningioma disease.
20472658 Observational study of gene-disease association. (HuGE Navigator)
20305614 there is a post-transcriptional SMARCB1/INI1 regulatory mechanism in the tumor cells of synovial sarcoma
20118769 Polyphenotypic immunohistochemical expression and focal loss of INI-1 protein in the rhabdoid areas of rhabdoid glioblastomas distinguished them from epithelioid glioblastomas.
20078948 PIH1D1 may stabilize SNF5 by attenuating its proteasome degradation pathway.
20003390 nine distinct pathogenic SMARCB1 mutations were identified in a total of 19 possible rhabdoid tumors
19913121 Observational study of gene-disease association. (HuGE Navigator)
19902524 Patients with germline mutation of SMARCB1 manifest at an early age and have a very high risk for progression to rhabdoid tumors.
19902524 Observational study of gene-disease association. (HuGE Navigator)
19808872 SNF5 may be an important marker for human melanoma progression and prognosis as well as a potential therapeutic target.
19805520 show that the human SWI/SNF component human SNF5 (hSNF5) interacts with UV damage recognition factor XPC and colocalizes with XPC at the damage site.
19750561 Most of the components of the SWI2/SNF2 chromatin remodeling complex (BRG1/BRM, BAF250, BAF180, BAF170, BAF155, BAF60a, BAF53A, actin and InI1) except BRM, BAF155 and BAF57, are identified to interact with HIV-1 Tat in Jurkat cell
19716452 Most of the components of the SWI2/SNF2 chromatin remodeling complex (BRG1/BRM, BAF250, BAF180, BAF170, BAF155, BAF60a, BAF53A, actin and InI1) except BRM, BAF155 and BAF57, are identified to interact with HIV-1 Tat in Jurkat cell
19683621 Direct evidence is reported of mutational inactivation of SMARCB1.
19582488 a familial SMARCB1 mutation has a role in schwannomatosis associated with multiple meningiomas [case report]
19515827 These results demonstrate the opposing effects of Ini1/hSNF5-containing SWI/SNF complexes on basal and Tat-dependent transcriptional activity of the HIV-1 promoter.
19515827 Most of the components of the SWI2/SNF2 chromatin remodeling complex (BRG1/BRM, BAF250, BAF180, BAF170, BAF155, BAF60a, BAF53A, actin and InI1) except BRM, BAF155 and BAF57, are identified to interact with HIV-1 Tat in Jurkat cell
19503603 study indicates HIV-1 integrase & INI1/hSNF5 bind SAP18 & recruit components of Sin3a-HDAC1 complex into HIV-1 virions; HIV-1 virion-associated HDAC1 is required for efficient early post-entry events, indicating novel role for HDAC1 in HIV-1 replication
19503603 Most of the components of the SWI2/SNF2 chromatin remodeling complex (BRG1/BRM, BAF250, BAF180, BAF170, BAF155, BAF60a, BAF53A, actin and InI1) except BRM, BAF155 and BAF57, are identified to interact with HIV-1 Tat in Jurkat cell
19480937 Recurrent loss, but lack of mutations, of the SMARCB1 tumor suppressor gene in T-cell prolymphocytic leukemia with TCL1A-TCRAD juxtaposition.
19454010 Most of the components of the SWI2/SNF2 chromatin remodeling complex (BRG1/BRM, BAF250, BAF180, BAF170, BAF155, BAF60a, BAF53A, actin and InI1) except BRM, BAF155 and BAF57, are identified to interact with HIV-1 Tat in Jurkat cell
19398554 INI1 residues involved in multimerization overlap with HIV-1 integrase-binding and nuclear export domains and are required for nuclear retention and co-localization with IN.
19398554 Most of the components of the SWI2/SNF2 chromatin remodeling complex (BRG1/BRM, BAF250, BAF180, BAF170, BAF155, BAF60a, BAF53A, actin and InI1) except BRM, BAF155 and BAF57, are identified to interact with HIV-1 Tat in Jurkat cell
19389610 Most of the components of the SWI2/SNF2 chromatin remodeling complex (BRG1/BRM, BAF250, BAF180, BAF170, BAF155, BAF60a, BAF53A, actin and InI1) except BRM, BAF155 and BAF57, are identified to interact with HIV-1 Tat in Jurkat cell
19351817 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19328320 Mutations may be present in familial and sporadic schwannomaatosis.
19320657 Identity analysis of schwannomatosis kindreds with recurrent constitutional SMARCB1 (INI1) alterations
19305156 Better understanding of the mechanisms by which mutation of SMARCB1 drive oncogenesis has the potential to identify novel therapeutic approaches for rhabdoid tumors and related cancers.
19276269 INI1 is the primary tumor suppressor gene involved in the development of rhabdoid tumors with no second locus identified.
19276269 Observational study of gene-disease association. (HuGE Navigator)
19232540 Most of the components of the SWI2/SNF2 chromatin remodeling complex (BRG1/BRM, BAF250, BAF180, BAF170, BAF155, BAF60a, BAF53A, actin and InI1) except BRM, BAF155 and BAF57, are identified to interact with HIV-1 Tat in Jurkat cell
19221586 Results show that the imprinted cell cycle inhibitor CDKN1C is a downstream target for SMARCB1 and is transcriptionally activated by increased histone H3 and H4 acetylation at the promoter.
19221051 Study show that the C-terminal SET domain of MLL3 and MLL4 directly interacts with INI1, an integral subunit of Swi/Snf.
19141382 Loss of expression of INI1 is frequent in the conventional and large cell subtypes of epithelioid sarcoma and can be used as a diagnostic marker, but it has no prognostic impact.
19124645 a germline 2631 bp duplication that includes exon 6 of SMARCB1 in a unique family with a four generation history of MRT predisposition and schwannomatosis.
19033866 Immunostaining for INI1 can be used to confirm the diagnosis of epithelioid sarcoma in the appropriate context.
19014595 Most of the components of the SWI2/SNF2 chromatin remodeling complex (BRG1/BRM, BAF250, BAF180, BAF170, BAF155, BAF60a, BAF53A, actin and InI1) except BRM, BAF155 and BAF57, are identified to interact with HIV-1 Tat in Jurkat cell
18997735 alterations of the INI1 gene with consequent loss of expression identified a population of undifferentiated sarcomas lacking classic rhabdoid morphology in young patients, with evidence of favorable survival
18985520 of INI1 immunostaining is a reliable marker for rhabdoid tumours and atypical teratoid/rhabdoid tumours in children.
18973917 Analysis of alterations in the SMARCB1/INI1 gene may be a useful for distinguishing proximal-type epithelioid sarcoma from malignant rhabdoid tumor.
18710953 Snf5-deficient primary cells do not show altered sensitivity to DNA damaging agents, defects in gamma-H2AX induction, or an abrogated DNA damage checkpoint.
18676838 inhibition of migration is another crucial tumor suppressor function of hSNF5/INI1, in addition to its previously described functions in proliferation and differentiation
18647326 SMARCB1 is a tumor suppressor for schwannomas in the context of familial disease.
18580682 Lack of SMARCB1 expression may be associated with rhabdoid features. The immunohistochemical result of the SMARCB1 expression is not an absolute diagnostic criteria for malignant rhabdoid tumor.
18422762 These results confirm a role for INI1/SMARCB1 in multiple schwannoma syndromes and suggest that a different pathway of tumorigenesis occurs in solitary, sporadic tumors.
18327209 the absence of INI1 expression is not necessarily predictive of rhabdoid histopathology but remains associated with aggressive behavior in renal medullary carcinoma.
18285426 In all affected individuals with SMARCB1 mutations and available tumour tissue, bi-allelic somatic inactivation of the NF2 gene, was detected.
18266055 two single nucleotide polymorphisms at the hSNF5/INI1 gene in exon 4 and exon 9 were found in controls and in Acute myeloid leukemia patients
18262058 SMARCB1 may be a tumor suppressor gene for malignant rhabdoid tumor.
18236049 present genetic evidence that the meningioma is not a recurrence or metastasis of the AT/RT and not due to the INI1 mutation, but is a radiation-induced tumour.
18087273 Transmission of a germline INI1-mutation in a rhabdoid tumor predisposition syndrome family via nonpenetrant males.
18072270 The latter observation suggests that a four-hit mechanism involving the SMARCB1 and NF2 genes may be implicated in schwannomatosis-related tumorigenesis.
17922027 hSNF5/INI1 cooperates with C/EBPbeta and PPARgamma2 transcriptional regulators to activate the expression of adipocyte-specific genes.
17717433 Loss of INI1 expression may rarely be encountered in tumors undergoing malignant transformation, but this is accompanied by mutation in the INI1 gene.
17699849 Microarray studies indicated that INI1 activated IFN-stimulated genes at early time points and senescence markers at late time points and repressed mitotic genes such as Polo like kinase 1 (PLK1), selectively in rhabdoid cells.
17669367 Gene expression profiling of the hSNF5-down-regulated cells by cDNA microarray analysis revealed that a limited number of p53-responsive genes, especially p21, were up-regulated
17616514 Knockdown experiments performed in human ALL cell lines confirmed that lower SMARCB1 expression increased prednisolone resistance.
17486366 Inactivation of the SMARCB1/INI1 gene is associated with rhabdoid tumor
17376508 results demonstrate that deletions and mutations of the INI1 gene can occur in rare composite rhabdoid tumors of adulthood
17357086 INI1 is the predisposing gene in familial schwannomatosis.
16945155 Most of the components of the SWI2/SNF2 chromatin remodeling complex (BRG1/BRM, BAF250, BAF180, BAF170, BAF155, BAF60a, BAF53A, actin and InI1) except BRM, BAF155 and BAF57, are identified to interact with HIV-1 Tat in Jurkat cell
16912184 Relationship between Rb and Ini1 in tumor suppression indicate that Ini1 plays a role in maintaining the morphologic and functional differentiation of corticotrophic cells.
16889668 While INI1 is dispensable for HIV-1 transduction, it can facilitate HIV-1 transcription by enhancing Tat function.
16889668 Most of the components of the SWI2/SNF2 chromatin remodeling complex (BRG1/BRM, BAF250, BAF180, BAF170, BAF155, BAF60a, BAF53A, actin and InI1) except BRM, BAF155 and BAF57, are identified to interact with HIV-1 Tat in Jurkat cell
16772295 by interacting with IN, SNF5/Ini1 interferes with early steps of HIV-1 infection
16772295 Most of the components of the SWI2/SNF2 chromatin remodeling complex (BRG1/BRM, BAF250, BAF180, BAF170, BAF155, BAF60a, BAF53A, actin and InI1) except BRM, BAF155 and BAF57, are identified to interact with HIV-1 Tat in Jurkat cell
16687403 Most of the components of the SWI2/SNF2 chromatin remodeling complex (BRG1/BRM, BAF250, BAF180, BAF170, BAF155, BAF60a, BAF53A, actin and InI1) except BRM, BAF155 and BAF57, are identified to interact with HIV-1 Tat in Jurkat cell
16568092 BAF155 and potentially INI1 are substrates for Akt phosphorylation
16528370 Immunohistochemistry to assess expression of SMARCB1/INI1 may be useful in the diagnosis of rhabdoid tumors of the CNS, kidneys and soft tissue.
16403635 Most of the components of the SWI2/SNF2 chromatin remodeling complex (BRG1/BRM, BAF250, BAF180, BAF170, BAF155, BAF60a, BAF53A, actin and InI1) except BRM, BAF155 and BAF57, are identified to interact with HIV-1 Tat in Jurkat cell
16288006 hSNF5 binds the p16INK4a and p21CIP/WAF1 promoters, suggesting that it directly regulates transcription of these genes. hSNF5 loss may influence the regulation of multiple CDK inhibitors involved in replicative senescence.
16267391 All conserved domains of INI1/hSNF5/BAF47 are needed for CSF1 transcription and INI1/ hSNF5/BAF47 is recruited to the region of the CSF1 promoter.
16219292 INI1/hSNF5/BAF47 could be recruited to the region of cellular oncogene c-fos promoter to reduce histone acetylation
16154112 This strongly suggests that the SNF5 homology domain presents species-specific functions.
16075307 Most of the components of the SWI2/SNF2 chromatin remodeling complex (BRG1/BRM, BAF250, BAF180, BAF170, BAF155, BAF60a, BAF53A, actin and InI1) except BRM, BAF155 and BAF57, are identified to interact with HIV-1 Tat in Jurkat cell
15993274 INI1hSNF5 and PARVG do not seem to be the tumor suppressor genes involved in oligodendroglioma development and progression
15981100 Tumors harbored such hSNF5/INI1 aberrations as germline single base deletion (492/6 delC) and missense mutation (C157T) together with LOH 22q or homozygous deletion. Cyclin D1 was overexpressed in the same tumors.
15899790 SMARCB1/INI1 inactivation to 6 of 11 cases of epithelioid sarcoma is shown by real-time quantitative PCR analysis of mRNA expression and by SMARCB1/INI1 immunohistochemistry.
15875659 Most of the components of the SWI2/SNF2 chromatin remodeling complex (BRG1/BRM, BAF250, BAF180, BAF170, BAF155, BAF60a, BAF53A, actin and InI1) except BRM, BAF155 and BAF57, are identified to interact with HIV-1 Tat in Jurkat cell
15796965 The tumor suppressor gene hSNF5 was lacking in the malignant rhabdoid tumor of the liver.
15769941 hSNF5 activates the mitotic checkpoint through the p16INK4a-cyclinD/CDK4-pRb-E2F pathway, whereas loss of hSNF5 function in malignant rhabdoid tumor-derived cells leads to polyploidization and chromosomal instability.
15761491 INI1 immunohistochemistry is a relatively simple, sensitive, and specific technique for distinguishing malignant rhabdoid tumor and atypical teratoid/rhabdoid tumor from composite rhabdoid tumor.
15642401 Mutated in choroid plexus carcinoma.
15589835 INI1 is dispensable for retrovirus-induced cytoplasmic accumulation of PML and does not interfere with virus integration.
15489652 Immunohistochemical analysis of hSNF5/INI1 gene distinguishes renal and extra-renal malignant rhabdoid tumors from other pediatric soft tissue tumors by assessing loss of INI1 expression in rhabdoid tumors.
15175083 somatic point mutations of hSNF5/INI1 do not play a role in the pathogenesis of choroid plexus papilloma
15150092 hSNF5/INI1 may modulate the cell cycle control and cytoskeleton organization through the regulation of the retinoblastoma protein-E2F and Rho pathways.
15101046 Novel SMARCB1 germ-line deletions in neonatal congenital kidney rhabdoid tumors and brain primitive neuroectodermal tumors patients.
14990991 in human cells, SWI/SNF enzyme complex formation and the expression of many BRG1-dependent genes are independent of INI1.
14963118 transdominant mutant S6, harboring the minimal integrase interaction domain of INI1/hSNF5, blocks HIV-1 particle production but not that of the other retroviruses in 293T cells
14963118 Most of the components of the SWI2/SNF2 chromatin remodeling complex (BRG1/BRM, BAF250, BAF180, BAF170, BAF155, BAF60a, BAF53A, actin and InI1) except BRM, BAF155 and BAF57, are identified to interact with HIV-1 Tat in Jurkat cell
14604992 hSNF5-induced cellular senescence is mediated by the p16(INK4a)/pRb pathway
14526201 alternative splicing and role implicated in interaction with HIV-1
12892231 germline hSNF5 mutation is associated with rhabdoid predisposition syndrome
12548550 INI1 is a tumor suppressor gene gone awry in malignant rhabdoid tumor cells
12213194 Mutation may alter the amount of cMYC protein, but SMARCB1 is highly conserved in human solid carcinomas.
12138206 Data suggest that one mechanism by which INI1/hSNF5 exerts its tumor suppressor function is by mediating the cell cycle arrest due to the direct recruitment of HDAC activity to the cyclin D1 promoter, causing its repression and G(0)-G(1) arrest.
12112529 The INI1 promoter is not hypermethylated in pediatric rhabdoid tumors.
12082626 Chromatin remodeling factor encoded by ini1 induces G1 arrest and apoptosis in ini1-deficient cells.
12016208 facilitates the function of the growth arrest and DNA damage-inducible protein (GADD34) and modulates GADD34-bound protein phosphatase-1 activity
11950834 SWI/SNF complex interacts with tumor suppressor p53 and is necessary for the activation of p53-mediated transcription
11921280 Aberrations of the hSNF5/INI1 gene are restricted to malignant rhabdoid tumors or atypical teratoid/rhabdoid tumors in pediatric solid tumors.
11782395 The role of INI1 and the SWI/SNF complex in the development of rhabdoid tumors
11479624 Most of the components of the SWI2/SNF2 chromatin remodeling complex (BRG1/BRM, BAF250, BAF180, BAF170, BAF155, BAF60a, BAF53A, actin and InI1) except BRM, BAF155 and BAF57, are identified to interact with HIV-1 Tat in Jurkat cell
11430827 Most of the components of the SWI2/SNF2 chromatin remodeling complex (BRG1/BRM, BAF250, BAF180, BAF170, BAF155, BAF60a, BAF53A, actin and InI1) except BRM, BAF155 and BAF57, are identified to interact with HIV-1 Tat in Jurkat cell
10773452 Most of the components of the SWI2/SNF2 chromatin remodeling complex (BRG1/BRM, BAF250, BAF180, BAF170, BAF155, BAF60a, BAF53A, actin and InI1) except BRM, BAF155 and BAF57, are identified to interact with HIV-1 Tat in Jurkat cell
9448295 Most of the components of the SWI2/SNF2 chromatin remodeling complex (BRG1/BRM, BAF250, BAF180, BAF170, BAF155, BAF60a, BAF53A, actin and InI1) except BRM, BAF155 and BAF57, are identified to interact with HIV-1 Tat in Jurkat cell
7801128 Most of the components of the SWI2/SNF2 chromatin remodeling complex (BRG1/BRM, BAF250, BAF180, BAF170, BAF155, BAF60a, BAF53A, actin and InI1) except BRM, BAF155 and BAF57, are identified to interact with HIV-1 Tat in Jurkat cell
7627549 Most of the components of the SWI2/SNF2 chromatin remodeling complex (BRG1/BRM, BAF250, BAF180, BAF170, BAF155, BAF60a, BAF53A, actin and InI1) except BRM, BAF155 and BAF57, are identified to interact with HIV-1 Tat in Jurkat cell

AA Sequence

MMMMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEERKKIVASSHGK      1 - 70
KTKPNTKDHGYTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSH     71 - 140
HLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMNE    141 - 210
KLMTPEMFSEILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILEDQSDQRVIIKLNIHVGNISLVDQFE    211 - 280
WDMSEKENSPEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQWC    281 - 350
PLLETLTDAEMEKKIRDQDRNTRRMRRLANTAPAW                                       351 - 385
//

Text Mined References (222)

PMID Year Title
26520417 2016 The diagnostic utility of reduced immunohistochemical expression of SMARCB1 in synovial sarcomas: a validation study.
26364901 2015 Report of a patient with a constitutional missense mutation in SMARCB1, Coffin-Siris phenotype, and schwannomatosis.
26350979 2015 Comparative molecular genetic analysis of simian and human HIV-1 integrase interactor INI1/SMARCB1/SNF5.
26342709 2015 Identification of a novel germline SMARCB1 nonsense mutation in a family manifesting both schwannomatosis and unilateral vestibular schwannoma.
26342593 2016 Rhabdoid tumor predisposition syndrome caused by SMARCB1 constitutional deletion: prenatal detection of new case of recurrence in siblings due to gonadal mosaicism.
26261664 2015 A SMARCB1-deficient vulvar neoplasm with prominent myxoid stroma: report of a case showing ERG and FLI1 expression.
26171919 2015 Myoepithelioma-like Tumors of the Vulvar Region: A Distinctive Group of SMARCB1-deficient Neoplasms.
26109171 2015 Integrated genomics has identified a new AT/RT-like yet INI1-positive brain tumor subtype among primary pediatric embryonal tumors.
26073604 2015 The SWI/SNF Subunit INI1 Contains an N-Terminal Winged Helix DNA Binding Domain that Is a Target for Mutations in Schwannomatosis.
25754356 2015 Use of clinical next-generation sequencing to identify melanomas harboring SMARCB1 mutations.
25663425 2015 Detection of SMARCB1 loss in ascites cells in the diagnosis of an abdominal rhabdoid tumor.
25651469 2015 SMARCB1-deficient Vulvar Neoplasms: A Clinicopathologic, Immunohistochemical, and Molecular Genetic Study of 14 Cases.
25649007 2015 Is INI1-retained small cell undifferentiated histology in hepatoblastoma unfavorable?
25559666 2015 Interaction between Nef and INI1/SMARCB1 augments replicability of HIV-1 in resting human peripheral blood mononuclear cells.
25496315 2015 Frequent co-inactivation of the SWI/SNF subunits SMARCB1, SMARCA2 and PBRM1 in malignant rhabdoid tumours.
25479928 2015 ERG and SALL4 expressions in SMARCB1/INI1-deficient tumors: a useful tool for distinguishing epithelioid sarcoma from malignant rhabdoid tumor.
25271443 2014 The SWI/SNF subunit/tumor suppressor BAF47/INI1 is essential in cell cycle arrest upon skeletal muscle terminal differentiation.
25246033 2014 Pathology and diagnosis of SMARCB1-deficient tumors.
25200863 2014 Concurrent loss of INI1, PBRM1, and BRM expression in epithelioid sarcoma: implications for the cocontributions of multiple SWI/SNF complex members to pathogenesis.
25168959 2014 Genotype-phenotype correlation of Coffin-Siris syndrome caused by mutations in SMARCB1, SMARCA4, SMARCE1, and ARID1A.
25103069 2015 Pancreatic undifferentiated rhabdoid carcinoma: KRAS alterations and SMARCB1 expression status define two subtypes.
25081545 2014 Numerous BAF complex genes are mutated in Coffin-Siris syndrome.
25009291 2014 SNF5/INI1 deficiency redefines chromatin remodeling complex composition during tumor development.
25007146 2014 SMARCB1 (INI-1)-deficient carcinomas of the sinonasal tract.
24983247 2014 Genotyping cancer-associated genes in chordoma identifies mutations in oncogenes and areas of chromosomal loss involving CDKN2A, PTEN, and SMARCB1.
24933152 2014 SMARCB1 mutations in schwannomatosis and genotype correlations with rhabdoid tumors.
24853101 2014 Mechanisms by which SMARCB1 loss drives rhabdoid tumor growth.
24832165 2014 SMARCB1(INI1)-deficient sinonasal basaloid carcinoma: a novel member of the expanding family of SMARCB1-deficient neoplasms.
24585572 2014 Consistent SMARCB1 homozygous deletions in epithelioid sarcoma and in a subset of myoepithelial carcinomas can be reliably detected by FISH in archival material.
24525513 2014 SMARCB1 involvement in the development of leiomyoma in a patient with schwannomatosis.
24503755 2014 SMARCB1 (INI1)-negative rhabdoid carcinomas of the gastrointestinal tract: clinicopathologic and molecular study of a highly aggressive variant with literature review.
24418192 2014 Genome-wide approach to identify second gene targets for malignant rhabdoid tumors using high-density oligonucleotide microarrays.
24327545 2014 SMARCB1 expression in epithelioid sarcoma is regulated by miR-206, miR-381, and miR-671-5p on Both mRNA and protein levels.
24287458 2014 Differential microRNA expression profiles between malignant rhabdoid tumor and epithelioid sarcoma: miR193a-5p is suggested to downregulate SMARCB1 mRNA expression.
24286138 2013 The chromatin remodelling component SMARCB1/INI1 influences the metastatic behavior of colorectal cancer through a gene signature mapping to chromosome 22.
24285714 2013 Role of SWI/SNF in acute leukemia maintenance and enhancer-mediated Myc regulation.
24204904 2013 Fibroblast growth factor receptors as novel therapeutic targets in SNF5-deleted malignant rhabdoid tumors.
24123847 2014 Favorable outcome of patients affected by rhabdoid tumors due to rhabdoid tumor predisposition syndrome (RTPS).
24075062 2013 Immunohistochemical validation of INI1/SMARCB1 in a spectrum of musculoskeletal tumors: an experience at a Tertiary Cancer Referral Centre.
23904343 2013 Inactivating mutations in SWI/SNF chromatin remodeling genes in human cancer.
23851497 2014 Cytoplasmic interaction of the tumour suppressor protein hSNF5 with dynamin-2 controls endocytosis.
23815551 2014 Coffin-Siris syndrome is a SWI/SNF complex disorder.
23799881 2013 INI1/hSNF5-interaction defective HIV-1 IN mutants exhibit impaired particle morphology, reverse transcription and integration in vivo.
23593299 2013 Structural and functional role of INI1 and LEDGF in the HIV-1 preintegration complex.
23576573 2013 SMARCB1/INI1 genetic inactivation is responsible for tumorigenic properties of epithelioid sarcoma cell line VAESBJ.
23540691 2013 Reversible disruption of mSWI/SNF (BAF) complexes by the SS18-SSX oncogenic fusion in synovial sarcoma.
23435428 2014 Activation of ?-catenin/TCF targets following loss of the tumor suppressor SNF5.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23364536 2013 SNF5 reexpression in malignant rhabdoid tumors regulates transcription of target genes by recruitment of SWI/SNF complexes and RNAPII to the transcription start site of their promoters.
23348212 2013 Renal medullary carcinoma: molecular, immunohistochemistry, and morphologic correlation.
23245672 2013 A unique pattern of INI1 immunohistochemistry distinguishes synovial sarcoma from its histologic mimics.
23174932 2013 SMARCB1 protein and mRNA loss is not caused by promoter and histone hypermethylation in epithelioid sarcoma.
23074045 2013 High-resolution genomic analysis suggests the absence of recurrent genomic alterations other than SMARCB1 aberrations in atypical teratoid/rhabdoid tumors.
23060122 2013 Epithelioid sarcoma is associated with a high percentage of SMARCB1 deletions.
22949514 2012 Expression of SMARCB1 (INI1) mutations in familial schwannomatosis.
22797305 2012 A remarkably simple genome underlies highly malignant pediatric rhabdoid cancers.
22752724 2012 RNA-based analysis of two SMARCB1 mutations associated with familial schwannomatosis with meningiomas.
22698742 2012 [BEX2 regulates cell cycle through the interaction with INI1/hSNF5].
22686875 2012 SMARCB1/INI1 inactivation in renal medullary carcinoma.
22672440 2013 Loss of INI1 protein expression defines a subgroup of aggressive central nervous system primitive neuroectodermal tumors.
22614000 2012 SMARCB1 deficiency in tumors from the peripheral nervous system: a link between schwannomas and rhabdoid tumors?
22544318 2012 Epigenetic inactivation of the tumor suppressor BIN1 drives proliferation of SNF5-deficient tumors.
22490415 2012 Integrase interactor 1 regulates proliferation, apoptosis and invasion in gastric cancer cells.
22479537 2012 The chromatin remodeling factor SMARCB1 forms a complex with human cytomegalovirus proteins UL114 and UL44.
22434358 2012 Frequency of SMARCB1 mutations in familial and sporadic schwannomatosis.
22426308 2012 Mutations affecting components of the SWI/SNF complex cause Coffin-Siris syndrome.
22368283 2012 Human PIH1 associates with histone H4 to mediate the glucose-dependent enhancement of pre-rRNA synthesis.
22082606 2012 Epithelioid malignant peripheral nerve sheath tumor arising in a schwannoma, in a patient with "neuroblastoma-like" schwannomatosis and a novel germline SMARCB1 mutation.
22038540 2012 Germline SMARCB1 mutation predisposes to multiple meningiomas and schwannomas with preferential location of cranial meningiomas at the falx cerebri.
22020042 2012 Intact INI1 gene region with paradoxical loss of protein expression in AT/RT: implications for a possible novel mechanism associated with absence of INI1 protein immunoreactivity.
21809989 2011 Embryonal central nervous system neoplasms arising in infants and young children: a pediatric brain tumor consortium study.
21705046 2011 Immunohistochemical analysis of SMARCB1/INI-1 expression in collecting duct carcinoma.
21637919 2011 RB1CC1 activates the p16 promoter through the interaction with hSNF5.
21613800 2011 Heterozygosity loss at 22q and lack of INI1 gene mutation in gastrointestinal stromal tumor.
21521802 2011 Aurora A is a repressed effector target of the chromatin remodeling protein INI1/hSNF5 required for rhabdoid tumor cell survival.
21494030 2011 Absence of mutations on the SNF5 gene in hematological neoplasms with chromosome 22 abnormalities.
21269460 2011 Initial characterization of the human central proteome.
21255467 2011 SMARCB1/INI1 germline mutations contribute to 10% of sporadic schwannomatosis.
21240060 2011 INI1 immunohistochemical expression in glioblastoma: correlation with MGMT gene promoter methylation status and patient survival.
21208904 2011 Frequent hSNF5/INI1 germline mutations in patients with rhabdoid tumor.
21159874 2011 Inhibition of early stages of HIV-1 assembly by INI1/hSNF5 transdominant negative mutant S6.
21159066 2011 Atypical teratoid/rhabdoid tumor: short clinical description and insight into possible mechanism of the disease.
21127945 2011 A complex karyotype in an atypical teratoid/rhabdoid tumor: case report and review of the literature.
21108436 2011 Spectrum of SMARCB1/INI1 mutations in familial and sporadic rhabdoid tumors.
21057957 2010 Loss of SMARCB1/INI1 expression in poorly differentiated chordomas.
20932739 2011 Prognostic determinants in epithelioid sarcoma.
20930055 2011 Germline SMARCB1 mutation and somatic NF2 mutations in familial multiple meningiomas.
20829602 2011 hSNF5 is required for human papillomavirus E2-driven transcriptional activation and DNA replication.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20506188 2010 The human SWI/SNF complex associates with RUNX1 to control transcription of hematopoietic target genes.
20472658 2010 SMARCB1 mutations are not a common cause of multiple meningiomas.
20305614 2010 Reduced expression of SMARCB1/INI1 protein in synovial sarcoma.
20118769 2010 Epithelioid versus rhabdoid glioblastomas are distinguished by monosomy 22 and immunohistochemical expression of INI-1 but not claudin 6.
20111005 2010 Crosstalk between C/EBPbeta phosphorylation, arginine methylation, and SWI/SNF/Mediator implies an indexing transcription factor code.
20078948 2009 [Effect of PIH1D1 on the degradation of its binding protein SNF5].
20003390 2009 Rapid detection of SMARCB1 sequence variation using high resolution melting.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19902524 2010 Clinical and molecular features in patients with atypical teratoid rhabdoid tumor or malignant rhabdoid tumor.
19808872 2009 Loss of SNF5 expression correlates with poor patient survival in melanoma.
19805520 2009 Human SNF5/INI1, a component of the human SWI/SNF chromatin remodeling complex, promotes nucleotide excision repair by influencing ATM recruitment and downstream H2AX phosphorylation.
19683621 2009 Re: Infrequent SMARCB1/INI1 gene alteration in epithelioid sarcoma: a useful tool in distinguishing epithelioid sarcoma from malignant rhabdoid tumor: Direct evidence of mutational inactivation of SMARCB1/INI1 in epithelioid sarcoma.
19582488 2010 Schwannomatosis associated with multiple meningiomas due to a familial SMARCB1 mutation.
19515827 2009 Integrase interactor 1 (Ini1/hSNF5) is a repressor of basal human immunodeficiency virus type 1 promoter activity.
19503603 2009 Recruitment of a SAP18-HDAC1 complex into HIV-1 virions and its requirement for viral replication.
19480937 2009 Recurrent loss, but lack of mutations, of the SMARCB1 tumor suppressor gene in T-cell prolymphocytic leukemia with TCL1A-TCRAD juxtaposition.
19398554 2009 Multimerization and DNA binding properties of INI1/hSNF5 and its functional significance.
19351817 2009 Genetic mutations associated with cigarette smoking in pancreatic cancer.
19328320 2009 [Molecular characterisation of SMARCB1 and NF2 in familial and sporadic schwannomatosis: an evolving paradigm].
19320657 2009 Identity analysis of schwannomatosis kindreds with recurrent constitutional SMARCB1 (INI1) alterations.
19305156 2009 The role of SMARCB1/INI1 in development of rhabdoid tumor.
19276269 2009 Genomic analysis using high-density single nucleotide polymorphism-based oligonucleotide arrays and multiplex ligation-dependent probe amplification provides a comprehensive analysis of INI1/SMARCB1 in malignant rhabdoid tumors.
19234532 2009 The role of INI1/hSNF5 in gene regulation and cancer.
19221586 2009 Imprinted CDKN1C is a tumor suppressor in rhabdoid tumor and activated by restoration of SMARCB1 and histone deacetylase inhibitors.
19221051 2009 Crucial roles for interactions between MLL3/4 and INI1 in nuclear receptor transactivation.
19141382 2009 Epithelioid sarcoma: a clinicopathologic and immunohistochemical analysis of 106 cases from the French sarcoma group.
19124645 2009 Familial occurrence of schwannomas and malignant rhabdoid tumour associated with a duplication in SMARCB1.
19033866 2009 Loss of INI1 expression is characteristic of both conventional and proximal-type epithelioid sarcoma.
18997735 2009 Loss of INI1 expression defines a unique subset of pediatric undifferentiated soft tissue sarcomas.
18985520 2008 Rhabdoid tumour: a malignancy of early childhood with variable primary site, histology and clinical behaviour.
18973917 2009 Infrequent SMARCB1/INI1 gene alteration in epithelioid sarcoma: a useful tool in distinguishing epithelioid sarcoma from malignant rhabdoid tumor.
18765789 2008 Regulation of muscle development by DPF3, a novel histone acetylation and methylation reader of the BAF chromatin remodeling complex.
18710953 2008 Loss of the epigenetic tumor suppressor SNF5 leads to cancer without genomic instability.
18676838 2008 RhoA-dependent regulation of cell migration by the tumor suppressor hSNF5/INI1.
18647326 2008 Alterations in the SMARCB1 (INI1) tumor suppressor gene in familial schwannomatosis.
18580682 2008 SMARCB1/INI1 protein expression in round cell soft tissue sarcomas associated with chromosomal translocations involving EWS: a special reference to SMARCB1/INI1 negative variant extraskeletal myxoid chondrosarcoma.
18422762 2008 Immunohistochemical analysis supports a role for INI1/SMARCB1 in hereditary forms of schwannomas, but not in solitary, sporadic schwannomas.
18327209 2008 Renal medullary carcinoma: rhabdoid features and the absence of INI1 expression as markers of aggressive behavior.
18285426 2008 Molecular characterisation of SMARCB1 and NF2 in familial and sporadic schwannomatosis.
18266055 2008 hSNF5 /INI1 mutation analysis in acute myeloid leukemia.
18262058 2008 A novel mutation of the SMARCB1 gene in a case of extrarenal malignant rhabdoid tumor.
18236049 2008 Secondary meningioma in a long-term survivor of atypical teratoid/rhabdoid tumour with a germline INI1 mutation.
18087273 2008 Long-term survival and transmission of INI1-mutation via nonpenetrant males in a family with rhabdoid tumour predisposition syndrome.
18072270 2008 Evidence of a four-hit mechanism involving SMARCB1 and NF2 in schwannomatosis-associated schwannomas.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17922027 2008 The requirement for SNF5/INI1 in adipocyte differentiation highlights new features of malignant rhabdoid tumors.
17717433 2007 Immunohistochemistry of INI1 expression: a new tool for old challenges in CNS and soft tissue pathology.
17699849 2007 INI1 induces interferon signaling and spindle checkpoint in rhabdoid tumors.
17669367 2007 Knock down of hSNF5/Ini1 causes cell cycle arrest and apoptosis in a p53-dependent manner.
17616514 2007 Expression of SMARCB1 modulates steroid sensitivity in human lymphoblastoid cells: identification of a promoter SNP that alters PARP1 binding and SMARCB1 expression.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17486366 2007 Highly aggressive behavior of malignant rhabdoid tumor: a special reference to SMARCB1/INI1 gene alterations using molecular genetic analysis including quantitative real-time PCR.
17376508 2007 Mutation of the INI1 gene in composite rhabdoid tumor of the endometrium.
17357086 2007 Germline mutation of INI1/SMARCB1 in familial schwannomatosis.
16912184 2006 Functional interaction of the retinoblastoma and Ini1/Snf5 tumor suppressors in cell growth and pituitary tumorigenesis.
16889668 2006 The integrase interactor 1 (INI1) proteins facilitate Tat-mediated human immunodeficiency virus type 1 transcription.
16772295 2006 Inhibition of early steps of HIV-1 replication by SNF5/Ini1.
16687403 2006 The SWI/SNF chromatin-remodeling complex is a cofactor for Tat transactivation of the HIV promoter.
16601680 2006 Requirement for SWI/SNF chromatin-remodeling complex in Tat-mediated activation of the HIV-1 promoter.
16568092 2006 Members of the hSWI/SNF chromatin remodeling complex associate with and are phosphorylated by protein kinase B/Akt.
16528370 2006 Absence of expression of SMARCB1/INI1 in malignant rhabdoid tumors of the central nervous system, kidneys and soft tissue: an immunohistochemical study with implications for diagnosis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16314535 2005 Human SWI/SNF generates abundant, structurally altered dinucleosomes on polynucleosomal templates.
16288006 2005 Loss of the hSNF5 gene concomitantly inactivates p21CIP/WAF1 and p16INK4a activity associated with replicative senescence in A204 rhabdoid tumor cells.
16267391 2005 Chromatin-remodeling factor INI1/hSNF5/BAF47 is involved in activation of the colony stimulating factor 1 promoter.
16219292 2005 INI1/hSNF5/BAF47 represses c-fos transcription via a histone deacetylase-dependent manner.
16217013 2005 Heterogeneous nuclear ribonucleoprotein C1/C2, MeCP1, and SWI/SNF form a chromatin remodeling complex at the beta-globin locus control region.
16154112 2005 Complementation analyses suggest species-specific functions of the SNF5 homology domain.
15993274 2005 No evidence of INI1hSNF5 (SMARCB1) and PARVG point mutations in oligodendroglial neoplasms.
15985610 2005 PBAF chromatin-remodeling complex requires a novel specificity subunit, BAF200, to regulate expression of selective interferon-responsive genes.
15981100 2005 Cyclin D1 is overexpressed in atypical teratoid/rhabdoid tumor with hSNF5/INI1 gene inactivation.
15899790 2005 SMARCB1/INI1 tumor suppressor gene is frequently inactivated in epithelioid sarcomas.
15796965 2005 Establishment of a cell line from a malignant rhabdoid tumor of the liver lacking the function of two tumor suppressor genes, hSNF5/INI1 and p16.
15769941 2005 Cancer-associated mutations in chromatin remodeler hSNF5 promote chromosomal instability by compromising the mitotic checkpoint.
15761491 2005 INI1 expression is retained in composite rhabdoid tumors, including rhabdoid meningiomas.
15642401 2005 Mutational analysis of hSNF5/INI1 and TP53 genes in choroid plexus carcinomas.
15589835 2004 Ini1/hSNF5 is dispensable for retrovirus-induced cytoplasmic accumulation of PML and does not interfere with integration.
15489652 2004 Immunohistochemical analysis of hSNF5/INI1 distinguishes renal and extra-renal malignant rhabdoid tumors from other pediatric soft tissue tumors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15175083 2004 No evidence of hSNF5/INI1 point mutations in choroid plexus papilloma.
15150092 2004 The tumor suppressor hSNF5/INI1 modulates cell growth and actin cytoskeleton organization.
15101046 2004 Novel germ-line deletion of SNF5/INI1/SMARCB1 gene in neonate presenting with congenital malignant rhabdoid tumor of kidney and brain primitive neuroectodermal tumor.
14990991 2004 Loss of the INI1 tumor suppressor does not impair the expression of multiple BRG1-dependent genes or the assembly of SWI/SNF enzymes.
14963118 2004 Specificity of interaction of INI1/hSNF5 with retroviral integrases and its functional significance.
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14604992 2004 P16INK4a is required for hSNF5 chromatin remodeler-induced cellular senescence in malignant rhabdoid tumor cells.
14526201 2003 High frequency of alternative splicing of human genes participating in the HIV-1 life cycle: a model using TSG101, betaTrCP, PPIA, INI1, NAF1, and PML.
12892231 2003 Molecular analysis of the rhabdoid predisposition syndrome in a child: a novel germline hSNF5/INI1 mutation and absence of c-myc amplification.
12665591 2003 Novel SWI/SNF chromatin-remodeling complexes contain a mixed-lineage leukemia chromosomal translocation partner.
12637547 2003 Ets-2 and components of mammalian SWI/SNF form a repressor complex that negatively regulates the BRCA1 promoter.
12620397 2003 Molecular cloning, genomic structure and interactions of the putative breast tumor suppressor TACC2.
12548550 2003 INI1 expression induces cell cycle arrest and markers of senescence in malignant rhabdoid tumor cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12368262 2002 Identification of a polymorphic, neuron-specific chromatin remodeling complex.
12226744 2002 A key role of the hSNF5/INI1 tumour suppressor in the control of the G1-S transition of the cell cycle.
12213194 2002 A single-nucleotide polymorphism of SMARCB1 in human breast cancers.
12200431 2002 Largest subunits of the human SWI/SNF chromatin-remodeling complex promote transcriptional activation by steroid hormone receptors.
12145209 2002 Targeting of SWI/SNF chromatin remodelling complexes to estrogen-responsive genes.
12138206 2002 Cell cycle arrest and repression of cyclin D1 transcription by INI1/hSNF5.
12016208 2002 The human SNF5/INI1 protein facilitates the function of the growth arrest and DNA damage-inducible protein (GADD34) and modulates GADD34-bound protein phosphatase-1 activity.
11950834 2002 SWI/SNF complex interacts with tumor suppressor p53 and is necessary for the activation of p53-mediated transcription.
11880634 2002 Phosphatidylinositol-dependent actin filament binding by the SWI/SNF-like BAF chromatin remodeling complex.
11782423 2002 A masked NES in INI1/hSNF5 mediates hCRM1-dependent nuclear export: implications for tumorigenesis.
11756182 2002 The MLL fusion partner AF10 binds GAS41, a protein that interacts with the human SWI/SNF complex.
11734557 2002 SYT associates with human SNF/SWI complexes and the C-terminal region of its fusion partner SSX1 targets histones.
11726552 2001 Fanconi anemia protein, FANCA, associates with BRG1, a component of the human SWI/SNF complex.
11479624 2001 Inhibition of HIV-1 virion production by a transdominant mutant of integrase interactor 1.
11430827 2001 Cytoplasmic recruitment of INI1 and PML on incoming HIV preintegration complexes: interference with early steps of viral replication.
11259590 2001 Site-specific acetylation by p300 or CREB binding protein regulates erythroid Krüppel-like factor transcriptional activity via its interaction with the SWI-SNF complex.
11085541 2000 BRG1, a component of the SWI-SNF complex, is mutated in multiple human tumor cell lines.
11078522 2000 The human SWI/SNF-B chromatin-remodeling complex is related to yeast rsc and localizes at kinetochores of mitotic chromosomes.
10773452 2000 Inactivation of the SNF5 transcription factor gene abolishes the lethal phenotype induced by the expression of HIV-1 integrase in yeast.
10739763 2000 Familial posterior fossa brain tumors of infancy secondary to germline mutation of the hSNF5 gene.
10688647 2000 Recruitment of the SWI-SNF chromatin remodeling complex as a mechanism of gene activation by the glucocorticoid receptor tau1 activation domain.
10619021 1999 A C/EBP beta isoform recruits the SWI/SNF complex to activate myeloid genes.
10521299 1999 Constitutional mutations of the hSNF5/INI1 gene predispose to a variety of cancers.
10490642 1999 Leukemic HRX fusion proteins inhibit GADD34-induced apoptosis and associate with the GADD34 and hSNF5/INI1 proteins.
10365963 1999 Interaction of E1 and hSNF5 proteins stimulates replication of human papillomavirus DNA.
10319872 1999 c-MYC interacts with INI1/hSNF5 and requires the SWI/SNF complex for transactivation function.
10208879 1999 The mouse ortholog of the human SMARCB1 gene encodes two splice forms.
10078207 1999 Reconstitution of a core chromatin remodeling complex from SWI/SNF subunits.
9892189 1999 Germ-line and acquired mutations of INI1 in atypical teratoid and rhabdoid tumors.
9710619 1998 A human RNA polymerase II complex containing factors that modify chromatin structure.
9671307 1998 Truncating mutations of hSNF5/INI1 in aggressive paediatric cancer.
9448295 1998 Structure-function analysis of integrase interactor 1/hSNF5L1 reveals differential properties of two repeat motifs present in the highly conserved region.
8895581 1996 Purification and biochemical heterogeneity of the mammalian SWI-SNF complex.
8804307 1996 Diversity and specialization of mammalian SWI/SNF complexes.
8709224 1996 Epstein-Barr virus nuclear protein 2 (EBNA2) binds to a component of the human SNF-SWI complex, hSNF5/Ini1.
7801128 1994 Binding and stimulation of HIV-1 integrase by a human homolog of yeast transcription factor SNF5.
7739891 1995 A human protein with homology to Saccharomyces cerevisiae SNF5 interacts with the potential helicase hbrm.
7627549 1995 HIV integration. Ini1 for integration?