Property Summary

NCBI Gene PubMed Count 60
PubMed Score 120.58
PubTator Score 68.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.138 1.0e-02
Multiple myeloma 1.337 2.8e-04
cutaneous lupus erythematosus 1.300 1.4e-03
psoriasis -1.400 1.8e-04
osteosarcoma -1.324 1.0e-04
sonic hedgehog group medulloblastoma 1.400 5.0e-06
medulloblastoma, large-cell 1.200 6.4e-06
primitive neuroectodermal tumor 1.100 2.1e-04
Amyotrophic Lateral Sclerosis 1.013 2.6e-06
tuberculosis and treatment for 3 months -1.100 1.2e-05
active Crohn's disease 1.151 9.0e-03
pediatric high grade glioma 1.100 1.0e-05
lung adenocarcinoma -1.300 2.5e-21
invasive ductal carcinoma 1.100 1.3e-03
ovarian cancer 1.500 3.2e-04

Gene RIF (30)

PMID Text
27019336 The action of SNF2H at CTCF sites is functionally important as depletion of CTCF or SNF2H affects transcription of a common group of genes.
25684208 Data show the mechanism of nucleosome sliding by the chromatin remodeling motor SNF2h protein.
25533843 CHD3.1 and ACF1-SNF2H display counteractive activities but similar histone affinities.
25377162 Knockdown of SMARCA5 expression in MDA-MB-231 and MDA-MB-435s cell lines.
24990377 SMARCA5 targeting to UV-C damage depends on transcription and histone modifications and requires functional SWI2/SNF2-ATPase and SLIDE domains.
24607692 this study finds that the H4 tail promotes ATP-binding pocket closure in SNF2h.
24498324 Data show that CCCTC-binding factor (CTCF) together with ISWI ATPase SMARCA5 and members of the Cohesin complex associate with the SPI1 protein is disrupted in acute myeloid leukemia (AML) blasts.
23319141 Data indicate that the heterochromatic H2A.X is preferentially phosphorylated presumably by the accumulating WSTF-ISWI chromatin remodeling (WICH) complex, and suggests that Tyr142p might have a specific role in heterochromatin.
23264744 study unveils a functional link between DNA damage-induced poly(ADP-ribosyl)ation, SMARCA5-mediated chromatin remodeling and RNF168-dependent signaling and repair of DSBs.
22525276 Introduction of the miR-99 family of miRNAs into cells reduced the rate and overall efficiency of repair by both homologous recombination and non-homologous end joining.
22242598 Functional interaction is characterized between C/EBPbeta and SNF2H/ACF1, involving mainly suppression of C/EBPbeta transactivation activity in the presence of SNF2H and ACF1.
21937426 Cdt1- and SNF2H-mediated promotion of MCM loading may be biologically relevant for the regulation of DNA replication.
21900490 These results demonstrate a novel role for ISWI (SNF2h) as a survival factor during the cellular response to hypoxia
21738833 ISWI proteins Snf2H, Snf2L as well as Acf1 accumulate at UV-induced DNA damage sites within tens of seconds and reach a plateau after a few minutes.
21519849 [review] Biochemical analysis using a mutant Vpr HIV-1 gene suggests that Vpr binds chromatin-remodeling factor SNF2h via HFRIG (i.e., amino acids 71-75).
21519849 HIV-1 Vpr directly binds SNF2H and the Vpr mutant lacking amino acids 71-75 abolishes its binding to SNF2H
21261476 SMARCA5 has a potential role in proliferation and malignancy in gastric carcinogenesis.
21249171 SNF2H is required for efficient HSV-1 replication and promotes virus immediate-early gene expression.
21172662 The ATP-dependent chromatin-remodeling factor, SNF2H, accumulate rapidly at DSBs and is required for DSB repair in human cells.
21113140 This is the first description of a fusion between EWSR1 and a chromatin-reorganizing gene(SMARCA5) in Ewing sarcoma/PNET.
20974961 ISWI remodelers operate via a "continuous sampling" mechanism.
19940112 Data conclude that H2A.Z incorporation increases nucleosome remodeling activity of the largest class of mammalian remodelers (ISWI) and that it correlates with increased association of other remodelers to chromatin.
19454010 HIV-1 Vpr directly binds SNF2H and the Vpr mutant lacking amino acids 71-75 abolishes its binding to SNF2H
18553938 The ability to sense adjacent DNA is a general property of the binding partners of SNF2h and that each partner provides distinct regulation that contributes to distinct cellular function.
18519663 findings suggest that interaction between Rsf-1 and hSNF2H may define a survival signal in those tumors overexpressing Rsf-1
16877760 ACF1 alters the remodeling strategy of SNF2h
16603771 WSTF-SNF2h-NM1 forms a platform in transcription while providing chromatin remodeling
16514417 Nuclear myosin 1 (NM1)-Williams syndrome transcription factor (WSTF)-SMARCA5/SNF2h complex binds RNA polymerase I and ribosomal DNA rDNA).
15543136 WSTF-ISWI complex has a role in the maintenance of chromatin structures during DNA replication.
12972596 Human RSF is composed of two subunits: ATPase hSNF2H and p325 (Rsf-1).

AA Sequence

MSSAAEPPPPPPPESAPSKPAASIASGGSNSSNKGGPEGVAAQAVASAASAGPADAEMEEIFDDASPGKQ      1 - 70
KEIQEPDPTYEEKMQTDRANRFEYLLKQTELFAHFIQPAAQKTPTSPLKMKPGRPRIKKDEKQNLLSVGD     71 - 140
YRHRRTEQEEDEELLTESSKATNVCTRFEDSPSYVKWGKLRDYQVRGLNWLISLYENGINGILADEMGLG    141 - 210
KTLQTISLLGYMKHYRNIPGPHMVLVPKSTLHNWMSEFKRWVPTLRSVCLIGDKEQRAAFVRDVLLPGEW    211 - 280
DVCVTSYEMLIKEKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWSL    281 - 350
LNFLLPDVFNSADDFDSWFDTNNCLGDQKLVERLHMVLRPFLLRRIKADVEKSLPPKKEVKIYVGLSKMQ    351 - 420
REWYTRILMKDIDILNSAGKMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDMHLVTNSGKMVVLDK    421 - 490
LLPKLKEQGSRVLIFSQMTRVLDILEDYCMWRNYEYCRLDGQTPHDERQDSINAYNEPNSTKFVFMLSTR    491 - 560
AGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQTKTVRVFRFITDNTVEERIVERAEMKLRLDSI    561 - 630
VIQQGRLVDQNLNKIGKDEMLQMIRHGATHVFASKESEITDEDIDGILERGAKKTAEMNEKLSKMGESSL    631 - 700
RNFTMDTESSVYNFEGEDYREKQKIAFTEWIEPPKRERKANYAVDAYFREALRVSEPKAPKAPRPPKQPN    701 - 770
VQDFQFFPPRLFELLEKEILFYRKTIGYKVPRNPELPNAAQAQKEEQLKIDEAESLNDEELEEKEKLLTQ    771 - 840
GFTNWNKRDFNQFIKANEKWGRDDIENIAREVEGKTPEEVIEYSAVFWERCNELQDIEKIMAQIERGEAR    841 - 910
IQRRISIKKALDTKIGRYKAPFHQLRISYGTNKGKNYTEEEDRFLICMLHKLGFDKENVYDELRQCIRNS    911 - 980
PQFRFDWFLKSRTAMELQRRCNTLITLIERENMELEEKEKAEKKKRGPKPSTQKRKMDGAPDGRGRKKKL    981 - 1050
KL                                                                       1051 - 1052
//

Text Mined References (71)

PMID Year Title
27019336 2016 The Chromatin Remodelling Enzymes SNF2H and SNF2L Position Nucleosomes adjacent to CTCF and Other Transcription Factors.
26100909 2015 BEND3 represses rDNA transcription by stabilizing a NoRC component via USP21 deubiquitinase.
25684208 2015 A nucleotide-driven switch regulates flanking DNA length sensing by a dimeric chromatin remodeler.
25533843 2014 Opposing ISWI- and CHD-class chromatin remodeling activities orchestrate heterochromatic DNA repair.
25377162 2015 Overexpression of SMARCA5 correlates with cell proliferation and migration in breast cancer.
24990377 2014 Human ISWI complexes are targeted by SMARCA5 ATPase and SLIDE domains to help resolve lesion-stalled transcription.
24607692 2014 The histone H4 tail regulates the conformation of the ATP-binding pocket in the SNF2h chromatin remodeling enzyme.
24498324 2014 Epigenetic control of SPI1 gene by CTCF and ISWI ATPase SMARCA5.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23319141 2013 The proteomic investigation of chromatin functional domains reveals novel synergisms among distinct heterochromatin components.
23264744 2013 Poly(ADP-ribosyl)ation links the chromatin remodeler SMARCA5/SNF2H to RNF168-dependent DNA damage signaling.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22525276 2013 The miR-99 family regulates the DNA damage response through its target SNF2H.
22242598 2012 Human CCAAT/enhancer-binding protein ? interacts with chromatin remodeling complexes of the imitation switch subfamily.
21937426 2011 Chromatin remodeler sucrose nonfermenting 2 homolog (SNF2H) is recruited onto DNA replication origins through interaction with Cdc10 protein-dependent transcript 1 (Cdt1) and promotes pre-replication complex formation.
21900490 2011 The chromatin remodeler ISWI regulates the cellular response to hypoxia: role of FIH.
21738833 Binding kinetics of human ISWI chromatin-remodelers to DNA repair sites elucidate their target location mechanism.
21519849 2011 Identification of SNF2h, a chromatin-remodeling factor, as a novel binding protein of Vpr of human immunodeficiency virus type 1.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21261476 2011 SMARCA5 methylation and expression in gastric cancer.
21249171 2011 Cellular SNF2H chromatin-remodeling factor promotes herpes simplex virus 1 immediate-early gene expression and replication.
21172662 2010 The ACF1 complex is required for DNA double-strand break repair in human cells.
21113140 2011 A novel t(4;22)(q31;q12) produces an EWSR1-SMARCA5 fusion in extraskeletal Ewing sarcoma/primitive neuroectodermal tumor.
20974961 2010 Human ISWI chromatin-remodeling complexes sample nucleosomes via transient binding reactions and become immobilized at active sites.
20850016 2010 Quantitative interaction proteomics and genome-wide profiling of epigenetic histone marks and their readers.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19940112 2010 Chromatin remodeling by imitation switch (ISWI) class ATP-dependent remodelers is stimulated by histone variant H2A.Z.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18553938 2008 Diverse regulation of SNF2h chromatin remodeling by noncatalytic subunits.
18519663 2008 The roles of human sucrose nonfermenting protein 2 homologue in the tumor-promoting functions of Rsf-1.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17693683 2007 Quantitative phosphoproteome profiling of Wnt3a-mediated signaling network: indicating the involvement of ribonucleoside-diphosphate reductase M2 subunit phosphorylation at residue serine 20 in canonical Wnt signal transduction.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16917504 2006 The N-CoR complex enables chromatin remodeler SNF2H to enhance repression by thyroid hormone receptor.
16877760 2006 Human ACF1 alters the remodeling strategy of SNF2h.
16603771 2006 The WSTF-SNF2h chromatin remodeling complex interacts with several nuclear proteins in transcription.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16514417 2006 The chromatin remodelling complex WSTF-SNF2h interacts with nuclear myosin 1 and has a role in RNA polymerase I transcription.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15775975 2005 Cell cycle regulation of chromatin at an origin of DNA replication.
15635413 2005 Nucleolar proteome dynamics.
15616580 2005 Histone modifications defining active genes persist after transcriptional and mitotic inactivation.
15543136 2004 The Williams syndrome transcription factor interacts with PCNA to target chromatin remodelling by ISWI to replication foci.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15284901 2004 Functional diversity of ISWI complexes.
15120635 2004 DNMT3B interacts with hSNF2H chromatin remodeling enzyme, HDACs 1 and 2, and components of the histone methylation system.
15009096 2004 Proteomics analysis of the centromere complex from HeLa interphase cells: UV-damaged DNA binding protein 1 (DDB-1) is a component of the CEN-complex, while BMI-1 is transiently co-localized with the centromeric region in interphase.
14729942 2004 Identification of phosphoproteins and their phosphorylation sites in the WEHI-231 B lymphoma cell line.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12972596 2003 Functional analysis of the subunits of the chromatin assembly factor RSF.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12434153 2002 An ACF1-ISWI chromatin-remodeling complex is required for DNA replication through heterochromatin.
12374985 2002 SATB1 targets chromatin remodelling to regulate genes over long distances.
12198550 2002 A chromatin remodelling complex that loads cohesin onto human chromosomes.
12167701 2002 The core of the polycomb repressive complex is compositionally and functionally conserved in flies and humans.
11980720 2002 WSTF-ISWI chromatin remodeling complex targets heterochromatic replication foci.
11532953 2001 NoRC--a novel member of mammalian ISWI-containing chromatin remodeling machines.
11435432 2001 Functional differences between the human ATP-dependent nucleosome remodeling proteins BRG1 and SNF2H.
10914549 2000 Chromatin remodeling gene SMARCA5 is dysregulated in primitive hematopoietic cells of acute leukemia.
10880450 2000 HuCHRAC, a human ISWI chromatin remodelling complex contains hACF1 and two novel histone-fold proteins.
10662543 2000 A novel family of bromodomain genes.
10655480 2000 A family of chromatin remodeling factors related to Williams syndrome transcription factor.
9836642 1998 Requirement of RSF and FACT for transcription of chromatin templates in vitro.
9730600 1998 Cloning and mapping of SMARCA5 encoding hSNF2H, a novel human homologue of Drosophila ISWI.