Property Summary

NCBI Gene PubMed Count 249
PubMed Score 662.96
PubTator Score 528.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Cardiovascular system disease 194 0.0 2.0
Myocardial Infarction 126 0.0 2.0
Disease Target Count Z-score Confidence
Intellectual disability 573 4.31 2.2
Disease Target Count
Coffin-Siris syndrome 4 1

Expression

  Differential Expression (22)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.093 1.6e-02
Multiple myeloma 1.298 8.1e-03
psoriasis 1.900 1.2e-04
osteosarcoma -1.249 1.0e-02
group 4 medulloblastoma 1.800 9.7e-06
astrocytoma 1.600 5.6e-03
atypical teratoid / rhabdoid tumor 1.600 4.0e-05
medulloblastoma, large-cell 2.000 7.9e-05
primitive neuroectodermal tumor 1.700 1.1e-04
juvenile dermatomyositis 1.003 7.6e-11
acute quadriplegic myopathy 1.545 2.8e-07
pancreatic ductal adenocarcinoma liver m... 1.557 6.2e-03
lung cancer 1.600 1.9e-04
colon cancer 1.200 5.3e-03
diabetes mellitus -1.100 2.9e-03
lung adenocarcinoma 1.081 8.2e-05
spina bifida -1.015 4.8e-02
progressive supranuclear palsy 1.100 2.3e-02
ductal carcinoma in situ 1.100 5.1e-04
invasive ductal carcinoma 1.100 1.1e-02
ovarian cancer 3.700 7.9e-09
dermatomyositis 1.300 6.5e-03

Gene RIF (178)

PMID Text
26966070 These results suggest that ARPE-19 cells possess an AHR-mediated transcription pathway with different target gene specificity, and that BRG1 is required for AHR-mediated transcription in ARPE-19 cells.
26842758 SMARCA4 is involved in the TOP1 recruitment to general chromatin, which suppresses transcription-associated genomic instability.
26645725 Loss of SMARCA4 expression is sensitive/specific for the diagnosis of small cell carcinoma of ovary, hypercalcemic type.
26642721 tetrandrine may inhibit the growth of Hep-2 cells by decreasing the intracellular concentration of Ca2+ and upregulating the expressions of Brg1 and AHNAK
26582913 Activation of DPF3a upon hypertrophic stimuli in cardiac hypertrophy switches cardiac fetal gene expression from being silenced by HEY to being activated by BRG1.
26571505 the role of SMARCA4 and the two SWI/SNF subunits SMARCD2/BAF60B and DPF2/BAF45D in leukaemia, was investigated.
26564006 our data suggest that concomitant loss of SMARCA2 and SMARCA4 is another hallmark of small cell carcinoma of the ovary, hypercalcemic type-a finding that offers new opportunities for therapeutic interventions.
26551623 this study shows for the first time novel SMARCA4-deficient and SMARCA2-deficient variants in undifferentiated gastrointestinal tract carcinomas
26356327 SMARCA4 loss, either alone or with SMARCA2, is highly sensitive and specific for small cell carcinoma of the ovary, hypercalcaemic type, restoration of either SWI/SNF ATPase can inhibit the growth of SCCOHT cell lines
26344687 Brg1 inhibits proliferation and migration of human aortic smooth muscle cells by directly up-regulating RRAD in aortic dissection.
26343384 prospective recruitment of cases confirmed this new category of 'SMARCA4-deficient thoracic sarcomas' as readily recognizable in clinical practice, providing opportunities to tailor their therapeutic management
26290144 The results do not support our hypothesis that common germline genetic variants in the SMARCA4 genes is associated with the risk of developing medulloblastoma.
26230154 Case Report: small cell carcinoma of the ovary, hypercalcemic type (SCCOHT) with SMARCA4 germline mutations.
26138476 Mutations in Coffin-Siris syndrome, a human intellectual disability disorder, localize to the BRG1 RNA-binding and DLX1-binding domains.
26135561 Lack of BRG1 expression is a useful tool for diagnosing ovarian small cell carcinomas of the hypercalcemic type.
26119756 these data uncover a direct regulatory relationship between miR-302 and the Brg1 chromatin remodeling complex that controls gene expression and cell fate decisions in hESCs and suggests that similar mechanisms are at play during early human development
26055322 A direct interaction between Ku70/86 and BRG1 brings together SWI/SNF remodeling capabilities and TOP2beta activity to enhance the transcriptional response to hormone stimulation.
25961913 Brg-1 inhibits the transcriptional activity of miR-550a-5p promoter, and decreased Brg-1 expression increased miR-550a-5p expression.
25886974 This study suggests that some women develop the ovarian SCCHT due to the inherited or possibly de novo-occurring germline alterations in the SMARCA4 gene, however, its penetrance appears limited.
25862816 PRC2 may inhibit immune surveillance, and it could be targeted to reactivate CIITA expression in SWI/SNF deficient cancers.
25808524 Knockout of BRG1 or BRM using CRISPR/Cas9 technology resulted in the loss of viability, consistent with a requirement for both enzymes in triple negative breast cancer cells
25803486 MITF-BRG1 interplay thus plays an essential role in transcription regulation in melanoma.
25731772 Most of the components of the SWI2/SNF2 chromatin remodeling complex (BRG1/BRM, BAF250, BAF180, BAF170, BAF155, BAF60a, BAF53A, actin and InI) except BRM, BAF155 and BAF57, are identified to interact with HIV-1 Tat in Jurkat cell
25724006 High level of BRG1, the same E2F binding motifs were docking sites for BRG1, induced chromatin compaction without CpG methylation but with increased histone deacetylation, associated with the presence of HDAC1 on E2F binding sites.
25568100 A reduction in the number of oligodendrocytes with myelin gene expression in the absence of Brg1 was identified.
25504753 This work therefore identifies BRG1-BRD as a novel tumor radiosensitizer.
25486475 BRG1/HDAC2 and beta-catenin constitute a manipulative apparatus at the transcription start site to play opposite but complementary roles in regulating hTERT expression.
25395584 BRG1-RAD52 complex mediates the replacement of RPA with RAD51 on single-stranded DNA (ssDNA) to initiate DNA strand invasion. Loss of BRG1 results in a failure of RAD51 loading onto ssDNA, abnormal homologous recombination repair
25355421 We reveal that SMARCA4 expression is regulated by miR-101, miR-199 and especially miR-155 through their binding to two alternative 3'UTRs.
25307865 Biallelic somatic SMARCA4 mutations in small cell carcinoma of the ovary, hypercalcemic type (SCCOHT).
25304030 BRG1 overexpression might promote the development of thoracic aortic dissection by increasing MMP2/MMP9 expression, inducing smooth apoptosis and the transition from contractile to synthetic phenotype.
25241744 BRG1 deficiency compromises the differentiation potential of human embryonic stem cells.
25168959 Genotype-phenotype correlation of Coffin-Siris syndrome caused by mutations in SmarCA4 gene.
25157878 BRG1 regulates transcriptional expression of many genes involved in cell stress response.
25115300 results offer direct evidence that BRG1 attenuation contributes to non-small cell lung cancer aggressiveness by altering nucleosome positioning at a wide range of genes, including key cancer-associated genes
25083560 The phosphorylation level of Brg1 at Ser1452 was down-regulated in ovarian clear cell adenocarcinoma.
25081545 BAF complex gene SMARCA4 is mutated in Coffin-Siris syndrome patients.
25060813 The genetic alterations of SMARCA4 in AT/RT are associated with a high rate of inherited germline mutations and aggressive biological behavior.
24993775 Data showed that BRG1 as target protein of UCA1 with anti-oncogenic features in bladder cancer cells. UCA1 blocked recruitment of BRG1 to its target promoter, and thus led to reduced expression of p21 and accelerated cell growth.
24875884 Studied BRG1 expression in thoracic aortic aneurysms and the roles of BRG1 and the lncRNA HIF 1 alpha-antisense RNA 1 in regulating the proliferation and apoptosis of aortic smooth muscle cells in vitro.
24700502 SMARCA4-associated CSS is a pleiotropic disorder in which the pathognomic clinical features evolve and for which the few reported individuals do not demonstrate a clear genotype-phenotype correlation.
24658004 Inactivating biallelic SMARCA4 mutations found in 100% of the 12 small cell carcinoma of the ovary, hypercalcemic type-tumors examined.
24658002 Germline and somatic SMARCA4 mutations characterize small cell carcinoma of the ovary, hypercalcemic type.
24658001 Small cell carcinoma of the ovary, hypercalcemic type, displays frequent inactivating germline and somatic mutations in SMARCA4.
24556940 SMARCA4 rs11879293 presented consistently significant associations with the risk of hepatocellular carcinoma
24421395 A SMARCA2-containing residual SWI/SNF complex underlies the oncogenic activity of SMARCA4 mutant cancers.
24413084 Data indicate that ataxia telangiectasia mutated (ATM) protein phosphorylates BRG1 protein at Ser-721.
24362264 Results show that BRG1 regulates the expression of MAX through direct recruitment to the MAX promoter, and that depletion of BRG1 strongly hinders cell growth in small cell lung cancer.
24362264 We demonstrated that BRG1 regulates the expression of the MYC-associated factor X gene, MAX, through direct recruitment to the MAX promoter, and that depletion of BRG1 strongly hinders cell growth, specifically in MAX-deficient cells, heralding a synthetic lethal interaction. Furthermore, MAX required BRG1 to activate neuroendocrine transcriptional programs and to upregulate MYC targets, such as glycolysis-related genes.
24190014 Allele T of rs1122608 was associated with an increased expression level of SFRS3 encoding an mRNA splicing regulator, but not with the expression of BRG1/SMARCA4 or LDLR
24042015 Brg1 provides the crucial epigenetic link to hypoxia-induced CAM induction and leukocyte adhesion that engenders endothelial malfunction and pathogenesis of hypoxic pulmonary hypertension.
23963727 Data suggest that Brg1 and Brm integrate various proinflammatory cues into cell adhesion molecule transactivation in endothelial injury.
23897427 Data indicate that transient knockdown of BRG1 or BRM reduces hypoxia induction of several known HIF1 and HIF2 target genes in Hep3B cells.
23872584 Loss of BRG1 expression is associated with lung cancer
23836109 The Brahma-related gene 1 (BRG1) was observed to selectively activate interferon-induced transmembrane protein 1 and interferon alpha-inducible protein 27 genes.
23815551 SMARCB1, SMARCA4, or ARID1B were mutated in 20 out of 49 Coffin-Siris syndrome patients.
23698369 studies indicate that the ability of TOP2A to prevent DNA entanglement at mitosis requires BAF complexes and suggest that this activity contributes to the role of BAF subunits as tumour suppressors
23533649 The results highlight the importance of BRG1 in breast cancer pathogenesis and BRG1 may serve as a prognostic marker as well as a potentially selective therapeutic target.
23480510 BRG1 regulates ML-IAP expression by cooperating with MITF to promote transcriptionally permissive chromatin structure on the ML-IAP promoter.
23438604 BRG1 enhances senescence induced by BRCA1 knockdown.
23392668 BRG1 is highly activated in Schwann cells at early stages of myelination, and loss of the enzyme inhibits their differentiation.
23349796 Data suggests that loss of BRG1-based SWI/SNF complexes negatively affects survival pathways beyond the MITF cascade.
23339192 a mechanism in which Brg1-containing SWI/SNF complexes are required for myocardin to induce expression of miRs-143/145 in smooth muscle cells
23276717 SMARCA4 rs11672232 and rs12232780 were associated with oligodendroglioma risk.
23163725 Loss of BRG1 and BRM was frequent in E-cadherin-low, TTF-1-low, and vimentin-high cases.
23088494 Although deletions and mutations in BRG1 gene were identified, the role of BRG1 in hepatocellular carcinoma tumourigenesis remains unclear.
23082233 E2F6 may recruit BRG1 in transcriptional regulation of genes important for G1/S phase transition of the cell cycle.
23076834 Data indicate three point mutations of KDM6A in Kabuki syndrome (KS).
22814607 Sox10 functions in Schwann cells by recruiting Brg1-containing chromatin-remodeling complexes.
22721696 SWI/SNF chromatin remodeling complex catalytic subunits Brg1 and Brm modulate cisplatin cytotoxicity by facilitating efficient repair of the cisplatin DNA lesions.
22573825 The beta-actin-Arp4 complex formation might be a crucial feature in some chromatin-modifying enzyme complexes, such as the Brg1 complex.
22563078 MSP58, p53, and the SWI/SNF chromatin-remodeling subunit Brahma-related gene 1 (BRG1) form a ternary complex on the p21 promoter and collaborate to activate p21.
22407764 BRG1 inactivation contributes to cancer by maintaining undifferentiated gene expression programs.
22407764 The study demonstrates that the lack of BRG1 in cancer prevents the control of cell differentiation, mediated by retinoids and corticoids. Furthermore, it provides functional evidence for an antagonistic functional connection between BRG1 and MYC.
22362300 BRG1 expression was increased in benign tumor and malignant tumor.
22262178 Knockdown of Brg1 leads to cell cycle arrest, p53 and Rb protein accumulation and, downregulated expression of HPV18 E6 and E7 genes.
22162999 SAF-A interacts with BRG1 and both components are required for RNA Polymerase II Mediated Transcription
21940037 Brg1 expression is lost in noninvasive cystic precursor lesions of pancreatic adenocarcinoma.
21900401 ARID1A interacts with BRG1 ATPase to form a SWI/SNF chromatin remodeling protein complex which interacts directly with p53 & then binds to CDKN1A & SMAD3 promoters.
21795385 We show that the catalytic subunit BRG1 of BAF complexes localizes to GATA1-bound distal sites during differentiation and generates a longer nucleosome linker region surrounding the GATA1 sites by shifting the flanking nucleosomes away
21730156 a complex composed of TERT, BRG1, and NS/GNL3L maintains the function of tumor initiating cells
21699904 Most of the components of the SWI2/SNF2 chromatin remodeling complex (BRG1/BRM, BAF250, BAF180, BAF170, BAF155, BAF60a, BAF53A, actin and InI) except BRM, BAF155 and BAF57, are identified to interact with HIV-1 Tat in Jurkat cell
21683060 BRG1-mediated chromatin remodeling is critical for the IFN-gamma-inducibility of TRIM22 gene.
21555518 SMARCA4 is a target gene of the BACH1 transcription factor according to ChIP-seq analysis in HEK 293 cells.
21520050 While point mutations of BRG1 proteins did not affect CD44 and CDH1 expression (known targets of the SWI/SNF complex), they did abrogate Rb-mediated cell-cycle arrest.
21317927 MicroRNA-21 targets tumor suppressor genes ANP32A and SMARCA4.
21284845 Our results suggest that Bap55 functions through the TIP60 chromatin remodeling complex to regulate dendrite wiring specificity in olfactory projection neurons.
21102582 Increased levels of BRG1 expression is associated with colorectal carcinoma.
21092585 The expression of BRG1 and BRM correlates with the development of prostatic cancer.
21079652 The hBrm/Brg1 switch is an indicator of the responsiveness of a gene to heat-shock or IFNgamma stimulation and may represent an "on-off switch" of gene expression in vivo.
20969766 The results suggest that increased BRG1 levels promote the epigenetic changes in gene expression required for melanoma metastasis to proceed.
20829883 BRG1 facilitates nucleosome traversal by RNAPII
20810930 Observational study of gene-disease association. (HuGE Navigator)
20697355 BRG1 upregulation by ectopic expression also induced senescence processes.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20599239 Most of the components of the SWI2/SNF2 chromatin remodeling complex (BRG1/BRM, BAF250, BAF180, BAF170, BAF155, BAF60a, BAF53A, actin and InI) except BRM, BAF155 and BAF57, are identified to interact with HIV-1 Tat in Jurkat cell
20596014 BRG1 is activated in certain patients with hypertrophic cardiomyopathy, its level correlating with disease severity and MHC changes
20506188 The interaction of RUNX1 with the SWI/SNF BRG1 and INI1 to control hematopoietic-specific gene expression is described.
20491765 BRG1 expression was increased in primary melanoma and metastatic melanoma compared with dysplastic naevi (P<0.0001) and not correlation was found between BRG1 expression and melanoma patient survival.
20418909 ZEB1/BRG1 as a new transcriptional mechanism regulating E-cadherin expression and epithelial-to-mesenchymal transdifferentiation
20333683 Knockdown of either BRM or BRG1 resulted in an inhibition of cell proliferation in monolayer cultures.
20164218 Overall, the authors concluded that BRG1 is required for Tax transactivation and HTLV-1 viral production and that the PBAF complex appears to be responsible for nucleosome remodeling.
20137775 SMARCA4 is involved in cancer predisposition
20011120 show that SWI/SNF activity favors (from subunits Brg1/Brm) loading of HP1 proteins to chromatin both in vivo and in vitro
19913121 Observational study of gene-disease association. (HuGE Navigator)
19901545 The chromatin remodeling factor BRG1(SMARCA4 protein)is recruited to sites of UV lesions to facilitate nucleotide excision repair in human chromatin.
19784067 Data suggest that heterogeneous SWI/SNF complexes composed of either the BRG1 or BRM subunit promote expression of distinct and overlapping MITF target genes.
19740755 Brg1 facilitates different stages of nucleotide excision repair by modulating UV-induced chromatin relaxation and stabilizing XPC at the damage sites, and subsequently stimulating the recruitment of XPG and PCNA to successfully culminate the repair.
19716452 Most of the components of the SWI2/SNF2 chromatin remodeling complex (BRG1/BRM, BAF250, BAF180, BAF170, BAF155, BAF60a, BAF53A, actin and InI) except BRM, BAF155 and BAF57, are identified to interact with HIV-1 Tat in Jurkat cell
19454010 Most of the components of the SWI2/SNF2 chromatin remodeling complex (BRG1/BRM, BAF250, BAF180, BAF170, BAF155, BAF60a, BAF53A, actin and InI) except BRM, BAF155 and BAF57, are identified to interact with HIV-1 Tat in Jurkat cell
19448667 Data demonstrate a novel function of the evolutionarily conserved chromatin remodeling subunit BRG1, which cooperates with CBP to constrain p53 activity and permit cancer cell proliferation.
19342595 The SWI/SNF chromatin remodeling complex regulates myocardin-induced smooth muscle-specific gene expression.
19220418 EKLF and the co-activator BRG1 are co-opted by short-chain fatty acid derivatives to activate the gamma globin genes
19183483 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19149898 Data report that p16INK4a interacts with the chromatin remodelling factor BRG1.
19144648 BRM and BRG1 SWI/SNF complexes have roles in differentiation
19066270 SMARCA4 expression was statistically significantly associated with prednisolone sensitivity. Prednisolone resistance was higher in SMARCA4 shRNA-transfected Jurkat cells than in control shRNA-transfected cells
18660489 Observational study of gene-disease association. (HuGE Navigator)
18508648 Translational view of human pathologic physiology involving SWI/SNF2 superfamily in human hereditary diseases an cancers. [REVIEW]
18500344 BRG1 regulates CIITA through many interdependent remote enhancers, not through the promoter alone.
18386774 The BRG1 gene is recurrently inactivated in non small cell lung cancer. Mutations were detected in 24% of the lung cancer cell lines. All mutations were homozygous and most predicted truncated proteins. Alterations at BRG1 always occurred in the absence of MYC amplification, suggesting a common role in lung cancer development.
18386774 This manuscript provides consistent demonstration that inactivating mutations at the SMARCA4 gene are commonly found in lung cancer cell lines. These observations provide evidence that SMARCA4 constitutes a tumor suppressor gene important in lung cancer.
18386774 alterations at BRG1 always occurred in the absence of MYC amplification, suggesting a common role in lung cancer development. In conclusion, our data strongly support that BRG1 is a bona fide tumor suppressor and a major factor in lung tumorigenesis
18345028 coordination of ERK signaling and NF-kappaB and Brg-1 activation are indispensable to regulation of Axl-dependent MMP-9 gene transcription
18239461 These studies suggest the endogenous cyclin D1 promoter BRG-1 binding site functions as a molecular scaffold in the context of local chromatin upon which coactivators and corepressors are recruited to regulate cyclin D1.
18086889 These studies suggest BAF250a is a necessary facilitator of BRG1-mediated chromatin remodeling required for SWI/SNF-dependent transcriptional activation.
18042045 at the TERT gene locus in human tumour cells containing a functional SWI/SNF complex, Brm, and possibly BRG1, in concert with p54(nrb), would initiate efficient transcription and could be involved in the subsequent splicing of TERT transcripts
18003620 Participation of BRG1 in TGFbeta action suggests a widespread yet differential involvement of BRG1 SWI/SNF remodeler in the transcriptional response of many genes to this cytokine.
17938176 p53 activity is differentially regulated by Brm- and Brg1-containing SWI/SNF chromatin remodeling complexes
17726060 The onset of chromatin remodelling corresponds with the binding of activated STAT1 and the chromatin remodelling enzyme BRG1 at specific sites within the MHC, and is followed by RNA-polymerase recruitment and histone hyperacetylation.
17723105 30 bp DNA element required for mediating the activation of CRYAB by brahma-related gene 1 (BRG1).
17672918 occurrence of an unusual TG 3' splice site in intron 29
17599918 Brg1/Brm containing SWI/SNF complexes play a critical role in regulating expression of SRF/MRTFA-dependent smooth muscle-specific genes but not SRF/MRTFA-dependent early response genes.
17582821 By modeling the acetylated-lysine peptide into the BRG1 bromodomain structure, we were able to explain the weak binding of acetylated-lysine peptides to this bromodomain
17468105 Both PCAF and BRG1 are also involved in the activation of the myogenin gene in rhabdomyosarcoma
17393431 nuclear actin regulates CSF1 gene transcription in a BRG1 independent manner.
17317669 IGF-1 induces phosphorylation and an increase of the AP1 complex, which is phosphorylated and binds to the pS2/TFF1 promoter, allowing recruitment of the chromatin remodeling factor Brg1 followed by binding of ERalpha via its interaction with c-Jun
17274598 Study reports the solution structure of the Brg1 bromodomain determined by using NMR perturbation studies; it was shown that the Brg1 bromodomain binds acetyllysine in the context of histone tails, with no comparable affinity for unacetylated peptides
17182572 BRG1 is constitutively present at IL-6-responsive promoters and is required for STAT3 recruitment, downstream histone modifications, and IL-6-induced chromatin remodeling.
17081121 primary micromolar interaction is through the AT-hook motif
17075831 Aberrant expression of BRG1 and BRM genes is associated with development and progression of prostate cancers and increased BRG1 expression may promote tumor growth and invasion.
17043312 Brg1 and HDAC2 have roles in GR trans-repression of the pituitary POMC gene and misexpression in Cushing disease
17023429 BRG1 facilitates REST repression by increasing the interaction between REST and chromatin
16923960 These results thus demonstrate that BRG1, through the facilitation of Z-DNA formation and subsequent recruitment of RNA polymerase II, is critical in Nrf2-mediated inducible expression of HO-1.
16800816 The SWI/SNF protein Brg1 is associated with a DNA-binding complex containing TAL1/SCL, E47, GATA-1, LMO2 and Ldb1 complex. Both the E box and GATA DNA-binding sites in these elements are required for Brg1 recruitment.
16687403 Most of the components of the SWI2/SNF2 chromatin remodeling complex (BRG1/BRM, BAF250, BAF180, BAF170, BAF155, BAF60a, BAF53A, actin and InI) except BRM, BAF155 and BAF57, are identified to interact with HIV-1 Tat in Jurkat cell
16537901 TG repeats are assembled in a positioned nucleosome in the silent colony-stimulating factor 1 (CSF1) promoter and that activation by BRG1 disrupts this nucleosome and results in Z-DNA formation.
16513088 Here antibody phage display technology is employed for development of an antibody specifically targeting BRG1.
16195385 BRG1 has an apical role in cytokine-induced promoter assembly, acting upstream of STAT complexes at multiple IFN target loci.
15999204 Brg1 co-localized with NF1/CTF & RNAP II in HeLa cells. It is isolated together with NF1/CTF & RNAP II in ConA-stimulated, but not resting, T lymphocytes. BAF complexes interact with NF1/CTF & RNAP II, dependent on activation of gene transcription.
15887247 BRG1 loss in pancreatic tumor cell lines induces an altered cell morphology and disruption in the organization of the actin cytoskeleton.
15731117 transcriptional activation of ZNF185 and CYP3A4 is mediated by direct association of BRG1 with their promoters and a decreased level of ZNF185 is a common feature of lung tumours
15347669 Brahma and Brahma/SWI2-related gene 1 have roles in hypoxic induction of the erythropoietin gene
15317818 Brg-1 plays a role in regulating the recruitment of Sp1, Sp3, AP-2, and polymerase II to the MMP-2 promoter.
15287030 Somatic point mutations of the SMARCA4 gene are present in a small subset of lung tumors.
15287030 Somatic point mutations of the BRG1 gene are present in a small subset of lung tumors
15286705 Sta3 regulates chromatin remodeling and transcription elongation through its interaction with BRG1 and cdk9
15240517 BRM and BRG1 participate in two distinct chromosome remodeling complexes that are functionally complementary in non-small cell lung cancer
15141164 BRG1 is required for growth suppression by estrogen antagonists.
14990991 in human cells, SWI/SNF enzyme complex formation and the expression of many BRG1-dependent genes are independent of INI1.
14555651 BRG1 has a role in promoting cell proliferation by interacting with EVI1, which blocks its repression on E2F1 activity
14530259 the amino-terminal and carboxyl-terminal regions of Mi-2 beta have distinct transcriptional activities and bind to BRG1 and the RET finger protein, forming a multiprotein supercomplex involved in transcriptional regulation.
12684665 Some mutations are found in prostate cancer, such as germline mutation, SNPs, but common mutations are excluded.
12620226 BRG1 and BRM complexes may direct distinct cellular processes by recruitment to specific promoters through protein-protein interactions that are unique to each ATPase.
12612078 The Brg1 subunit of SWI/SNF was shown to interact directly with RTA.
12566296 This report provides supportive evidence that BRG1 and BRM act as tumor suppressor proteins and implicates a role for their loss in the development of non-small cell lung cancers.
12493776 human adrenal carcinoma cells can spontaneously transition between two subtypes by switching expression of BRG1 and Brm at the post-transcriptional level
12411497 suggestion of an entirely novel function for BRG1 in modulating HP1alpha-containing heterochromatic structures
12244326 BRG1 interacts with signal transducer and activator of transcription 2 (STAT2) - a transcription factor that regulates gene expression mediated by interferon-alpha.
12192000 REST repression of neuronal genes requires components of the hSWI.SNF complex
12077331 CIITA requires the ATPase subunit of an hSWI/SNF complex, brahma-related gene 1 (BRG-1), to activate transcription.
12065415 Data show that prohibitin recruits Brg-1/Brm to E2F-responsive promoters, and that this recruitment is required for the repression of E2F-mediated transcription by prohibitin.
11953317 Interferon-gamma-induced chromatin remodeling at the CIITA locus is BRG1 dependent
11950834 SWI/SNF complex interacts with tumor suppressor p53 and is necessary for the activation of p53-mediated transcription
11937040 BRG1 enzymes generate localized changes in DNA topology that drive formation of multiple, remodeled nucleosomal states.
11805098 Functional involvement of the Brahma/SWI2-related gene 1 protein in cytochrome P4501A1 transcription mediated by the aryl hydrocarbon receptor complex
11779498 generation and interconversion of multiple distinct nucleosomal states as a mechanism for catalyzing chromatin fluidity
11719516 majority of tumor lines with germ line defects in BRG-1 were sensitive to RB-mediated cell cycle arrest

AA Sequence

MSTPDPPLGGTPRPGPSPGPGPSPGAMLGPSPGPSPGSAHSMMGPSPGPPSAGHPIPTQGPGGYPQDNMH      1 - 70
QMHKPMESMHEKGMSDDPRYNQMKGMGMRSGGHAGMGPPPSPMDQHSQGYPSPLGGSEHASSPVPASGPS     71 - 140
SGPQMSSGPGGAPLDGADPQALGQQNRGPTPFNQNQLHQLRAQIMAYKMLARGQPLPDHLQMAVQGKRPM    141 - 210
PGMQQQMPTLPPPSVSATGPGPGPGPGPGPGPGPAPPNYSRPHGMGGPNMPPPGPSGVPPGMPGQPPGGP    211 - 280
PKPWPEGPMANAAAPTSTPQKLIPPQPTGRPSPAPPAVPPAASPVMPPQTQSPGQPAQPAPMVPLHQKQS    281 - 350
RITPIQKPRGLDPVEILQEREYRLQARIAHRIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEV    351 - 420
VVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYH    421 - 490
RSVTGKIQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEY    491 - 560
VANLTELVRQHKAAQVAKEKKKKKKKKKAENAEGQTPAIGPDGEPLDETSQMSDLPVKVIHVESGKILTG    561 - 630
TDAPKAGQLEAWLEMNPGYEVAPRSDSEESGSEEEEEEEEEEQPQAAQPPTLPVEEKKKIPDPDSDDVSE    631 - 700
VDARHIIENAKQDVDDEYGVSQALARGLQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYN    701 - 770
NNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAA    771 - 840
RRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLT    841 - 910
GTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRL    911 - 980
KKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPY    981 - 1050
MFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRG   1051 - 1120
FKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRA   1121 - 1190
HRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESR   1191 - 1260
HCSTGSGSASFAHTAPPPAGVNPDLEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARN   1261 - 1330
PKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEI   1331 - 1400
EEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVI   1401 - 1470
KYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFN   1471 - 1540
LEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLK   1541 - 1610
GGRRRPSRGSRAKPVVSDDDSEEEQEEDRSGSGSEED                                    1611 - 1647
//

Text Mined References (260)

PMID Year Title
26966070 2016 Regulation of aryl hydrocarbon receptor-mediated transcription in human retinal pigmented epithelial cells.
26842758 2016 Chromatin remodeller SMARCA4 recruits topoisomerase 1 and suppresses transcription-associated genomic instability.
26645725 2016 Loss of SMARCA4 Expression Is Both Sensitive and Specific for the Diagnosis of Small Cell Carcinoma of Ovary, Hypercalcemic Type.
26642721 2015 Tetrandrine Inhibits the Intracellular Calcium Ion Level and Upregulates the Expression of Brg1 and AHNAK in Hep-2 Cells.
26582913 2016 Phosphorylation of the chromatin remodeling factor DPF3a induces cardiac hypertrophy through releasing HEY repressors from DNA.
26571505 2015 SWI/SNF Subunits SMARCA4, SMARCD2 and DPF2 Collaborate in MLL-Rearranged Leukaemia Maintenance.
26564006 2016 Concomitant loss of SMARCA2 and SMARCA4 expression in small cell carcinoma of the ovary, hypercalcemic type.
26551623 2016 SWI/SNF Complex-deficient Undifferentiated/Rhabdoid Carcinomas of the Gastrointestinal Tract: A Series of 13 Cases Highlighting Mutually Exclusive Loss of SMARCA4 and SMARCA2 and Frequent Co-inactivation of SMARCB1 and SMARCA2.
26356327 2016 Dual loss of the SWI/SNF complex ATPases SMARCA4/BRG1 and SMARCA2/BRM is highly sensitive and specific for small cell carcinoma of the ovary, hypercalcaemic type.
26344687 2015 Brahma-related gene 1 inhibits proliferation and migration of human aortic smooth muscle cells by directly up-regulating Ras-related associated with diabetes in the pathophysiologic processes of aortic dissection.
26343384 2015 SMARCA4 inactivation defines a group of undifferentiated thoracic malignancies transcriptionally related to BAF-deficient sarcomas.
26290144 2015 CCND2, CTNNB1, DDX3X, GLI2, SMARCA4, MYC, MYCN, PTCH1, TP53, and MLL2 gene variants and risk of childhood medulloblastoma.
26230154 Small Cell Carcinoma of the Ovary, Hypercalcemic Type: Report of a Bilateral Case in a Teenager Associated with SMARCA4 Germline Mutation.
26138476 2015 Evf2 lncRNA/BRG1/DLX1 interactions reveal RNA-dependent inhibition of chromatin remodeling.
26135561 2015 SMARCA4 (BRG1) loss of expression is a useful marker for the diagnosis of ovarian small cell carcinoma of the hypercalcemic type (ovarian rhabdoid tumor): a comprehensive analysis of 116 rare gynecologic tumors, 9 soft tissue tumors, and 9 melanomas.
26119756 2015 MiRNA-Mediated Regulation of the SWI/SNF Chromatin Remodeling Complex Controls Pluripotency and Endodermal Differentiation in Human ESCs.
26055322 2015 Glucocorticoid Receptor Transcriptional Activation via the BRG1-Dependent Recruitment of TOP2? and Ku70/86.
25961913 2016 Brg-1 targeting of novel miR550a-5p/RNF43/Wnt signaling axis regulates colorectal cancer metastasis.
25886974 2015 Germline SMARCA4 mutations in patients with ovarian small cell carcinoma of hypercalcemic type.
25862816 2015 Polycomb Repressive Complex 2 Confers BRG1 Dependency on the CIITA Locus.
25808524 2015 The SWI/SNF ATPases Are Required for Triple Negative Breast Cancer Cell Proliferation.
25803486 2015 Transcription factor MITF and remodeller BRG1 define chromatin organisation at regulatory elements in melanoma cells.
25724006 2015 De-regulated expression of the BRG1 chromatin remodeling factor in bone marrow mesenchymal stromal cells induces senescence associated with the silencing of NANOG and changes in the levels of chromatin proteins.
25569094 2015 Telomerase reverse transcriptase regulates microRNAs.
25568100 2015 Brg1-dependent chromatin remodelling is not essentially required during oligodendroglial differentiation.
25504753 2015 Targeting BRG1 chromatin remodeler via its bromodomain for enhanced tumor cell radiosensitivity in vitro and in vivo.
25486475 2014 BRG1, the ATPase subunit of SWI/SNF chromatin remodeling complex, interacts with HDAC2 to modulate telomerase expression in human cancer cells.
25395584 2015 BRG1 promotes the repair of DNA double-strand breaks by facilitating the replacement of RPA with RAD51.
25355421 2015 Expression inactivation of SMARCA4 by microRNAs in lung tumors.
25307865 2015 Biallelic somatic SMARCA4 mutations in small cell carcinoma of the ovary, hypercalcemic type (SCCOHT).
25304030 2014 BRG1 overexpression in smooth muscle cells promotes the development of thoracic aortic dissection.
25241744 2014 Transcriptional repression by the BRG1-SWI/SNF complex affects the pluripotency of human embryonic stem cells.
25168959 2014 Genotype-phenotype correlation of Coffin-Siris syndrome caused by mutations in SMARCB1, SMARCA4, SMARCE1, and ARID1A.
25157878 2014 Whole genome expression profiling shows that BRG1 transcriptionally regulates UV inducible genes and other novel targets in human cells.
25115300 2014 BRG1/SMARCA4 inactivation promotes non-small cell lung cancer aggressiveness by altering chromatin organization.
25083560 2014 Mass spectrometric analysis of the phosphorylation levels of the SWI/SNF chromatin remodeling/tumor suppressor proteins ARID1A and Brg1 in ovarian clear cell adenocarcinoma cell lines.
25081545 2014 Numerous BAF complex genes are mutated in Coffin-Siris syndrome.
25060813 2014 SMARCA4-mutated atypical teratoid/rhabdoid tumors are associated with inherited germline alterations and poor prognosis.
24993775 2014 Long non-coding RNA urothelial carcinoma associated 1 induces cell replication by inhibiting BRG1 in 5637 cells.
24875884 2015 BRG1 expression is increased in thoracic aortic aneurysms and regulates proliferation and apoptosis of vascular smooth muscle cells through the long non-coding RNA HIF1A-AS1 in vitro.
24700502 2014 Coffin-Siris syndrome: phenotypic evolution of a novel SMARCA4 mutation.
24658004 2014 Recurrent SMARCA4 mutations in small cell carcinoma of the ovary.
24658002 2014 Germline and somatic SMARCA4 mutations characterize small cell carcinoma of the ovary, hypercalcemic type.
24658001 2014 Small cell carcinoma of the ovary, hypercalcemic type, displays frequent inactivating germline and somatic mutations in SMARCA4.
24556940 2014 Genetic variant in SWI/SNF complexes influences hepatocellular carcinoma risk: a new clue for the contribution of chromatin remodeling in carcinogenesis.
24434208 2014 CARM1 methylates chromatin remodeling factor BAF155 to enhance tumor progression and metastasis.
24421395 2014 Residual complexes containing SMARCA2 (BRM) underlie the oncogenic drive of SMARCA4 (BRG1) mutation.
24413084 2015 ATM-mediated phosphorylation of the chromatin remodeling enzyme BRG1 modulates DNA double-strand break repair.
24362264 2014 MAX inactivation in small cell lung cancer disrupts MYC-SWI/SNF programs and is synthetic lethal with BRG1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24262325 2014 Shared genetic susceptibility to ischemic stroke and coronary artery disease: a genome-wide analysis of common variants.
24190014 2014 BRG1 variant rs1122608 on chromosome 19p13.2 confers protection against stroke and regulates expression of pre-mRNA-splicing factor SFRS3.
24042015 2013 Brahma-related gene 1 (Brg1) epigenetically regulates CAM activation during hypoxic pulmonary hypertension.
23963727 2013 Proinflammatory stimuli engage Brahma related gene 1 and Brahma in endothelial injury.
23897427 2013 BRG1 and BRM chromatin-remodeling complexes regulate the hypoxia response by acting as coactivators for a subset of hypoxia-inducible transcription factor target genes.
23872584 2013 A synthetic lethality-based strategy to treat cancers harboring a genetic deficiency in the chromatin remodeling factor BRG1.
23836109 2013 Brahma?related gene 1-associated expression of 9-27 and IFI-27 is involved in acquired cisplatin resistance of gastric cancer cells.
23815551 2014 Coffin-Siris syndrome is a SWI/SNF complex disorder.
23698369 2013 BAF complexes facilitate decatenation of DNA by topoisomerase II?.
23540691 2013 Reversible disruption of mSWI/SNF (BAF) complexes by the SS18-SSX oncogenic fusion in synovial sarcoma.
23533649 2013 BRG1 is a prognostic marker and potential therapeutic target in human breast cancer.
23480510 2013 BRG1 promotes survival of UV-irradiated melanoma cells by cooperating with MITF to activate the melanoma inhibitor of apoptosis gene.
23438604 2013 BRG1 is required for formation of senescence-associated heterochromatin foci induced by oncogenic RAS or BRCA1 loss.
23392668 2013 NF-?B forms a complex with the chromatin remodeler BRG1 to regulate Schwann cell differentiation.
23349796 2013 MITF-independent pro-survival role of BRG1-containing SWI/SNF complex in melanoma cells.
23339192 2013 Regulation of microRNAs by Brahma-related gene 1 (Brg1) in smooth muscle cells.
23276717 2013 SWI/SNF gene variants and glioma risk and outcome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23163725 2013 Lung cancer with loss of BRG1/BRM, shows epithelial mesenchymal transition phenotype and distinct histologic and genetic features.
23088494 2013 Alterations of the SWI/SNF chromatin remodelling subunit-BRG1 and BRM in hepatocellular carcinoma.
23082233 2012 E2F6 associates with BRG1 in transcriptional regulation.
23076834 2013 KDM6A point mutations cause Kabuki syndrome.
22814607 2012 Chromatin-remodeling factor Brg1 is required for Schwann cell differentiation and myelination.
22721696 2012 Downregulation of SWI/SNF chromatin remodeling factor subunits modulates cisplatin cytotoxicity.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22573825 2012 Heterocomplex formation by Arp4 and ?-actin is involved in the integrity of the Brg1 chromatin remodeling complex.
22563078 2012 58-kDa microspherule protein (MSP58) is novel Brahma-related gene 1 (BRG1)-associated protein that modulates p53/p21 senescence pathway.
22426308 2012 Mutations affecting components of the SWI/SNF complex cause Coffin-Siris syndrome.
22425674 2012 Chromatin remodeling during glucocorticoid receptor regulated transactivation.
22408259 2012 The FA pathway counteracts oxidative stress through selective protection of antioxidant defense gene promoters.
22407764 2012 The tumour suppressor and chromatin-remodelling factor BRG1 antagonizes Myc activity and promotes cell differentiation in human cancer.
22368283 2012 Human PIH1 associates with histone H4 to mediate the glucose-dependent enhancement of pre-rRNA synthesis.
22363625 2012 The BRG1 chromatin remodeler protects against ovarian cysts, uterine tumors, and mammary tumors in a lineage-specific manner.
22362300 2012 BRG1 expression is increased in human glioma and controls glioma cell proliferation, migration and invasion in vitro.
22262178 2012 Brg1 regulates the transcription of human papillomavirus type 18 E6 and E7 genes.
22162999 2011 SAF-A forms a complex with BRG1 and both components are required for RNA polymerase II mediated transcription.
21963585 2012 Focus on molecules: Brg1: a range of functions during eye development.
21940037 2012 Loss of expression of the SWI/SNF chromatin remodeling subunit BRG1/SMARCA4 is frequently observed in intraductal papillary mucinous neoplasms of the pancreas.
21900401 2011 ARID1A, a factor that promotes formation of SWI/SNF-mediated chromatin remodeling, is a tumor suppressor in gynecologic cancers.
21795385 2011 Regulation of nucleosome landscape and transcription factor targeting at tissue-specific enhancers by BRG1.
21730156 2011 Maintenance of tumor initiating cells of defined genetic composition by nucleostemin.
21683060 2011 BRG1 is indispensable for IFN-?-induced TRIM22 expression, which is dependent on the recruitment of IRF-1.
21555518 2011 The BTB and CNC homology 1 (BACH1) target genes are involved in the oxidative stress response and in control of the cell cycle.
21520050 2011 BRG1 mutations found in human cancer cell lines inactivate Rb-mediated cell-cycle arrest.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21378990 2011 Large-scale association analysis identifies 13 new susceptibility loci for coronary artery disease.
21347282 2011 Genome-wide association study of coronary heart disease and its risk factors in 8,090 African Americans: the NHLBI CARe Project.
21317927 2011 MicroRNA-21 targets tumor suppressor genes ANP32A and SMARCA4.
21284845 2011 The chromatin remodeling factor Bap55 functions through the TIP60 complex to regulate olfactory projection neuron dendrite targeting.
21269460 2011 Initial characterization of the human central proteome.
21102582 2011 Regulation of PTEN expression by the SWI/SNF chromatin-remodelling protein BRG1 in human colorectal carcinoma cells.
21092585 2010 [Expression of BRG1 and BRM proteins in prostatic cancer].
21079652 2010 A switch from hBrm to Brg1 at IFN?-activated sequences mediates the activation of human genes.
20969766 2010 Modulation of extracellular matrix/adhesion molecule expression by BRG1 is associated with increased melanoma invasiveness.
20829883 2010 BRG1 helps RNA polymerase II to overcome a nucleosomal barrier during elongation, in vivo.
20810930 2010 Polymorphisms at LDLR locus may be associated with coronary artery disease through modulation of coagulation factor VIII activity and independently from lipid profile.
20697355 2010 The BRG1 ATPase of chromatin remodeling complexes is involved in modulation of mesenchymal stem cell senescence through RB-P53 pathways.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20596014 2010 Chromatin regulation by Brg1 underlies heart muscle development and disease.
20506188 2010 The human SWI/SNF complex associates with RUNX1 to control transcription of hematopoietic target genes.
20491765 2010 BRG1 expression is increased in human cutaneous melanoma.
20418909 2010 ZEB1 represses E-cadherin and induces an EMT by recruiting the SWI/SNF chromatin-remodeling protein BRG1.
20333683 2010 SWI/SNF chromatin remodeling enzyme ATPases promote cell proliferation in normal mammary epithelial cells.
20224553 2010 A cooperative activation loop among SWI/SNF, gamma-H2AX and H3 acetylation for DNA double-strand break repair.
20164218 2010 Human T-lymphotropic virus type 1 transcription and chromatin-remodeling complexes.
20137775 2010 Germline nonsense mutation and somatic inactivation of SMARCA4/BRG1 in a family with rhabdoid tumor predisposition syndrome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20011120 2009 Interaction of HP1 and Brg1/Brm with the globular domain of histone H3 is required for HP1-mediated repression.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19901545 2009 The chromatin remodeling factor BRG1 stimulates nucleotide excision repair by facilitating recruitment of XPC to sites of DNA damage.
19784067 2010 Heterogeneous SWI/SNF chromatin remodeling complexes promote expression of microphthalmia-associated transcription factor target genes in melanoma.
19740755 2009 Modulation of nucleotide excision repair by mammalian SWI/SNF chromatin-remodeling complex.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19571879 2009 Telomerase modulates Wnt signalling by association with target gene chromatin.
19448667 2009 The SWI/SNF chromatin remodeling subunit BRG1 is a critical regulator of p53 necessary for proliferation of malignant cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19342595 2009 The SWI/SNF chromatin remodeling complex regulates myocardin-induced smooth muscle-specific gene expression.
19220418 2009 Erythroid Kruppel-like factor (EKLF) is recruited to the gamma-globin gene promoter as a co-activator and is required for gamma-globin gene induction by short-chain fatty acid derivatives.
19198609 2009 Genome-wide association of early-onset myocardial infarction with single nucleotide polymorphisms and copy number variants.
19183483 2009 Screening and association testing of common coding variation in steroid hormone receptor co-activator and co-repressor genes in relation to breast cancer risk: the Multiethnic Cohort.
19149898 2009 The chromatin remodelling factor BRG1 is a novel binding partner of the tumor suppressor p16INK4a.
19144648 2009 Antagonistic roles for BRM and BRG1 SWI/SNF complexes in differentiation.
19066270 2008 The SWI/SNF chromatin-remodeling complex and glucocorticoid resistance in acute lymphoblastic leukemia.
18816825 2008 Baf60c is a component of the neural progenitor-specific BAF complex in developing retina.
18765789 2008 Regulation of muscle development by DPF3, a novel histone acetylation and methylation reader of the BAF chromatin remodeling complex.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18508648 2008 Chromatin remodeling and SWI/SNF2 factors in human disease.
18500344 2008 The chromatin-remodeling enzyme BRG1 coordinates CIITA induction through many interdependent distal enhancers.
18487222 2008 Prohibitin and the SWI/SNF ATPase subunit BRG1 are required for effective androgen antagonist-mediated transcriptional repression of androgen receptor-regulated genes.
18386774 2008 Frequent BRG1/SMARCA4-inactivating mutations in human lung cancer cell lines.
18345028 2008 Axl promotes cell invasion by inducing MMP-9 activity through activation of NF-kappaB and Brg-1.
18303029 2008 BAF60a interacts with p53 to recruit the SWI/SNF complex.
18239461 2008 Inhibition of cyclin D1 gene transcription by Brg-1.
18086889 2008 The HSA domain of BRG1 mediates critical interactions required for glucocorticoid receptor-dependent transcriptional activation in vivo.
18042045 2008 Brm transactivates the telomerase reverse transcriptase (TERT) gene and modulates the splicing patterns of its transcripts in concert with p54(nrb).
18003620 2008 Genome-wide impact of the BRG1 SWI/SNF chromatin remodeler on the transforming growth factor beta transcriptional program.
17984088 2008 Dual role of NRSF/REST in activation and repression of the glucocorticoid response.
17938176 2007 The activity of p53 is differentially regulated by Brm- and Brg1-containing SWI/SNF chromatin remodeling complexes.
17726060 2007 P-STAT1 mediates higher-order chromatin remodelling of the human MHC in response to IFNgamma.
17723105 2007 HMGA1 mediates the activation of the CRYAB promoter by BRG1.
17672918 2007 Violating the splicing rules: TG dinucleotides function as alternative 3' splice sites in U2-dependent introns.
17599918 2007 A novel role of Brg1 in the regulation of SRF/MRTFA-dependent smooth muscle-specific gene expression.
17582821 2007 Structural ramification for acetyl-lysine recognition by the bromodomain of human BRG1 protein, a central ATPase of the SWI/SNF remodeling complex.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17468105 2007 Sequential recruitment of PCAF and BRG1 contributes to myogenin activation in 12-O-tetradecanoylphorbol-13-acetate-induced early differentiation of rhabdomyosarcoma-derived cells.
17393431 2007 Nuclear actin is involved in the regulation of CSF1 gene transcription in a chromatin required, BRG1 independent manner.
17317669 2007 Estrogen receptor alpha and the activating protein-1 complex cooperate during insulin-like growth factor-I-induced transcriptional activation of the pS2/TFF1 gene.
17274598 2007 Solution structure of human Brg1 bromodomain and its specific binding to acetylated histone tails.
17182572 2007 Brahma-related gene 1-dependent STAT3 recruitment at IL-6-inducible genes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17081121 DNA-binding properties of the recombinant high-mobility-group-like AT-hook-containing region from human BRG1 protein.
17075831 2007 Aberrant expression of SWI/SNF catalytic subunits BRG1/BRM is associated with tumor development and increased invasiveness in prostate cancers.
17043312 2006 Role of Brg1 and HDAC2 in GR trans-repression of the pituitary POMC gene and misexpression in Cushing disease.
17023429 2006 BRG1 chromatin remodeling activity is required for efficient chromatin binding by repressor element 1-silencing transcription factor (REST) and facilitates REST-mediated repression.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16923960 2006 BRG1 interacts with Nrf2 to selectively mediate HO-1 induction in response to oxidative stress.
16824695 2006 Epigenetic alterations of BRG1 leads to cancer development through its nuclear-cytoplasmic shuttling abnormalities.
16800816 2006 Recruitment of the SWI/SNF protein Brg1 by a multiprotein complex effects transcriptional repression in murine erythroid progenitors.
16730941 2006 A systematic analysis of human CHMP protein interactions: additional MIT domain-containing proteins bind to multiple components of the human ESCRT III complex.
16687403 2006 The SWI/SNF chromatin-remodeling complex is a cofactor for Tat transactivation of the HIV promoter.
16537901 2006 Cooperative activity of BRG1 and Z-DNA formation in chromatin remodeling.
16513088 2006 Isolation of an scFv targeting BRG1 using phage display with characterization by AFM.
16217013 2005 Heterogeneous nuclear ribonucleoprotein C1/C2, MeCP1, and SWI/SNF form a chromatin remodeling complex at the beta-globin locus control region.
16195385 2005 Apical role for BRG1 in cytokine-induced promoter assembly.
16051670 2005 hZimp7, a novel PIAS-like protein, enhances androgen receptor-mediated transcription and interacts with SWI/SNF-like BAF complexes.
15999204 2005 BAF complex is closely related to and interacts with NF1/CTF and RNA polymerase II in gene transcriptional activation.
15985610 2005 PBAF chromatin-remodeling complex requires a novel specificity subunit, BAF200, to regulate expression of selective interferon-responsive genes.
15887247 2005 BRG1 loss in MiaPaCa2 cells induces an altered cellular morphology and disruption in the organization of the actin cytoskeleton.
15781111 2005 Multiple interactions between BRG1 and MHC class II promoter binding proteins.
15774904 2005 Activation of ATP-binding cassette transporter A1 transcription by chromatin remodeling complex.
15731117 2005 Transcriptional targets of the chromatin-remodelling factor SMARCA4/BRG1 in lung cancer cells.
15635413 2005 Nucleolar proteome dynamics.
15616580 2005 Histone modifications defining active genes persist after transcriptional and mitotic inactivation.
15347669 2004 Roles of Brahma and Brahma/SWI2-related gene 1 in hypoxic induction of the erythropoietin gene.
15317818 2004 Brg-1 is required for maximal transcription of the human matrix metalloproteinase-2 gene.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15287030 2004 Genetic and epigenetic screening for gene alterations of the chromatin-remodeling factor, SMARCA4/BRG1, in lung tumors.
15286705 2004 Implication of BRG1 and cdk9 in the STAT3-mediated activation of the p21waf1 gene.
15240517 2004 Chromatin remodeling factors and BRM/BRG1 expression as prognostic indicators in non-small cell lung cancer.
15231747 2004 A protein interaction framework for human mRNA degradation.
15207703 2004 Bmx is a downstream Rap1 effector in VEGF-induced endothelial cell activation.
15141164 2004 BRG1/BRM and prohibitin are required for growth suppression by estrogen antagonists.
15075294 2004 TopBP1 recruits Brg1/Brm to repress E2F1-induced apoptosis, a novel pRb-independent and E2F1-specific control for cell survival.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14990991 2004 Loss of the INI1 tumor suppressor does not impair the expression of multiple BRG1-dependent genes or the assembly of SWI/SNF enzymes.
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14701856 2004 Transcription factors and nuclear receptors interact with the SWI/SNF complex through the BAF60c subunit.
14676191 2004 Comprehensive proteomic analysis of human Par protein complexes reveals an interconnected protein network.
14603256 2003 Conserved SNH domain of the proto-oncoprotein SYT interacts with components of the human chromatin remodelling complexes, while the QPGY repeat domain forms homo-oligomers.
14555651 2003 EVI1 promotes cell proliferation by interacting with BRG1 and blocking the repression of BRG1 on E2F1 activity.
14530259 2003 Mi-2 beta associates with BRG1 and RET finger protein at the distinct regions with transcriptional activating and repressing abilities.
12917342 2003 BAF60a mediates critical interactions between nuclear receptors and the BRG1 chromatin-remodeling complex for transactivation.
12889071 2003 Expression of the Wdr9 gene and protein products during mouse development.
12684665 2003 Mutation analysis of the BRG1 gene in prostate cancer clinical samples.
12637547 2003 Ets-2 and components of mammalian SWI/SNF form a repressor complex that negatively regulates the BRCA1 promoter.
12620226 2003 Transcriptional specificity of human SWI/SNF BRG1 and BRM chromatin remodeling complexes.
12612078 2003 Principal role of TRAP/mediator and SWI/SNF complexes in Kaposi's sarcoma-associated herpesvirus RTA-mediated lytic reactivation.
12566296 2003 Loss of BRG1/BRM in human lung cancer cell lines and primary lung cancers: correlation with poor prognosis.
12493776 2003 SW13 cells can transition between two distinct subtypes by switching expression of BRG1 and Brm genes at the post-transcriptional level.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12411497 2002 Selective interaction between the chromatin-remodeling factor BRG1 and the heterochromatin-associated protein HP1alpha.
12368262 2002 Identification of a polymorphic, neuron-specific chromatin remodeling complex.
12244326 2002 Chromatin-remodelling factor BRG1 selectively activates a subset of interferon-alpha-inducible genes.
12200431 2002 Largest subunits of the human SWI/SNF chromatin-remodeling complex promote transcriptional activation by steroid hormone receptors.
12192000 2002 REST repression of neuronal genes requires components of the hSWI.SNF complex.
12154023 2002 The BRCA1 and BARD1 association with the RNA polymerase II holoenzyme.
12077331 2002 The class II transactivator requires brahma-related gene 1 to activate transcription of major histocompatibility complex class II genes.
12065415 2002 Prohibitin requires Brg-1 and Brm for the repression of E2F and cell growth.
12044884 2002 A putative nuclear receptor coactivator (TMF/ARA160) associates with hbrm/hSNF2 alpha and BRG-1/hSNF2 beta and localizes in the Golgi apparatus.
11988099 2002 Cloning and characterization of hELD/OSA1, a novel BRG1 interacting protein.
11953317 2002 Interferon-gamma-induced chromatin remodeling at the CIITA locus is BRG1 dependent.
11950834 2002 SWI/SNF complex interacts with tumor suppressor p53 and is necessary for the activation of p53-mediated transcription.
11937040 2002 Chromatin remodeling: nucleosomes bulging at the seams.
11839798 2002 BAF53 forms distinct nuclear complexes and functions as a critical c-Myc-interacting nuclear cofactor for oncogenic transformation.
11805098 2002 Functional involvement of the Brahma/SWI2-related gene 1 protein in cytochrome P4501A1 transcription mediated by the aryl hydrocarbon receptor complex.
11780067 2001 Selectivity of chromatin-remodelling cofactors for ligand-activated transcription.
11734557 2002 SYT associates with human SNF/SWI complexes and the C-terminal region of its fusion partner SSX1 targets histones.
11726552 2001 Fanconi anemia protein, FANCA, associates with BRG1, a component of the human SWI/SNF complex.
11719516 2002 Compensation of BRG-1 function by Brm: insight into the role of the core SWI-SNF subunits in retinoblastoma tumor suppressor signaling.
11532957 2001 The chromatin remodelling factor Brg-1 interacts with beta-catenin to promote target gene activation.
11486022 2001 Transcriptional activation domains of human heat shock factor 1 recruit human SWI/SNF.
11445556 2001 LKB1 associates with Brg1 and is necessary for Brg1-induced growth arrest.
11414763 2001 Mutation analyses of 268 candidate genes in human tumor cell lines.
11108719 2001 The BRG-1 subunit of the SWI/SNF complex regulates CD44 expression.
11085541 2000 BRG1, a component of the SWI-SNF complex, is mutated in multiple human tumor cell lines.
11078522 2000 The human SWI/SNF-B chromatin-remodeling complex is related to yeast rsc and localizes at kinetochores of mitotic chromosomes.
11003650 2000 BRG-1 is recruited to estrogen-responsive promoters and cooperates with factors involved in histone acetylation.
10944117 2000 Both corepressor proteins SMRT and N-CoR exist in large protein complexes containing HDAC3.
10943845 2000 BRCA1 is associated with a human SWI/SNF-related complex: linking chromatin remodeling to breast cancer.
10619021 1999 A C/EBP beta isoform recruits the SWI/SNF complex to activate myeloid genes.
10204490 1999 Ikaros DNA-binding proteins direct formation of chromatin remodeling complexes in lymphocytes.
10078207 1999 Reconstitution of a core chromatin remodeling complex from SWI/SNF subunits.
9891079 1999 Cyclin E associates with BAF155 and BRG1, components of the mammalian SWI-SNF complex, and alters the ability of BRG1 to induce growth arrest.
9845365 1998 Rapid and phosphoinositol-dependent binding of the SWI/SNF-like BAF complex to chromatin after T lymphocyte receptor signaling.
9590696 1998 Chromatin remodelling by the glucocorticoid receptor requires the BRG1 complex.
9443979 1998 Factors associated with the mammalian RNA polymerase II holoenzyme.
9222609 1996 A pathway of multi-chaperone interactions common to diverse regulatory proteins: estrogen receptor, Fes tyrosine kinase, heat shock transcription factor Hsf1, and the aryl hydrocarbon receptor.
9099865 1997 Ligand-dependent interaction between the estrogen receptor and the human homologues of SWI2/SNF2.
8895581 1996 Purification and biochemical heterogeneity of the mammalian SWI-SNF complex.
8856972 1996 Sensing stress and responding to stress.
8804307 1996 Diversity and specialization of mammalian SWI/SNF complexes.
8670841 1996 The hbrm and BRG-1 proteins, components of the human SNF/SWI complex, are phosphorylated and excluded from the condensed chromosomes during mitosis.
8232556 1993 BRG1 contains a conserved domain of the SWI2/SNF2 family necessary for normal mitotic growth and transcription.
8208605 1994 Two human homologues of Saccharomyces cerevisiae SWI2/SNF2 and Drosophila brahma are transcriptional coactivators cooperating with the estrogen receptor and the retinoic acid receptor.
7923370 1994 The retinoblastoma protein and BRG1 form a complex and cooperate to induce cell cycle arrest.
7739891 1995 A human protein with homology to Saccharomyces cerevisiae SNF5 interacts with the potential helicase hbrm.