Property Summary

NCBI Gene PubMed Count 107
PubMed Score 331.13
PubTator Score 114.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Intellectual disability 573 4.584 2.3
Hypotrichosis 29 0.0 4.0
Disease Target Count
Nicolaides-Baraitser syndrome 2
Disease Target Count
Schizophrenia 503

Expression

  Differential Expression (22)

Disease log2 FC p
Rheumatoid Arthritis 1.300 1.3e-02
Waldenstrons macroglobulinemia 1.198 4.7e-03
Multiple myeloma 1.621 1.3e-03
psoriasis -2.000 4.9e-04
osteosarcoma 1.131 8.2e-03
atypical teratoid / rhabdoid tumor -1.200 1.7e-02
glioblastoma -1.200 9.7e-03
medulloblastoma, large-cell -1.300 1.4e-02
primitive neuroectodermal tumor -1.100 1.4e-02
hereditary spastic paraplegia -1.057 1.1e-02
adrenocortical adenoma 1.059 1.1e-02
lung cancer -3.400 1.3e-05
Parkinson's disease -1.100 4.0e-02
adult high grade glioma -1.200 3.0e-02
group 3 medulloblastoma -1.400 2.6e-02
aldosterone-producing adenoma -1.304 1.1e-02
subependymal giant cell astrocytoma -1.839 1.2e-02
Breast cancer -1.300 1.7e-08
invasive ductal carcinoma -1.100 1.0e-03
ovarian cancer -3.200 8.3e-06
Gaucher disease type 1 -1.400 9.6e-03
dermatomyositis -1.200 4.0e-03

Protein-protein Interaction (5)

MLP Assay (5)

AID Type Active / Inconclusive / Inactive Description
652017 screening 3838 / 0 / 365407 Luminescence-based cell-based primary high throughput screening assay to identify activators of the function of SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 (SMARCA2, BRM)
652022 summary 0 / 0 / 0 Summary of the probe development effort to identify activators of the function of SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 (SMARCA2, BRM)
652260 screening 1034 / 0 / 2465 Luminescence-based cell-based primary high throughput confirmation assay to identify activators of the function of SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 (SMARCA2, BRM)
686991 confirmatory 14 / 0 / 214 Luminescence-based cell-based high throughput dose response assay to identify activators of the function of SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 (SMARCA2, BRM)
720660 confirmatory 0 / 0 / 7 Luminescence-based cell-based late stage dose response assay to identify activators of the function of SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 (SMARCA2, BRM)

Gene RIF (65)

PMID Text
26564006 our data suggest that concomitant loss of SMARCA2 and SMARCA4 is another hallmark of small cell carcinoma of the ovary, hypercalcemic type-a finding that offers new opportunities for therapeutic interventions.
26551623 this study shows for the first time novel SMARCA4-deficient and SMARCA2-deficient variants in undifferentiated gastrointestinal tract carcinomas
26356327 SMARCA4 loss, either alone or with SMARCA2, is highly sensitive and specific for small cell carcinoma of the ovary, hypercalcaemic type, restoration of either SWI/SNF ATPase can inhibit the growth of SCCOHT cell lines
25808524 Knockout of BRG1 or BRM using CRISPR/Cas9 technology resulted in the loss of viability, consistent with a requirement for both enzymes in triple negative breast cancer cells
25731772 Brm-type SWI/SNF chromatin remodeling complex is required for the occasional transcriptional elongation of the HIV-1 provirus in the absence of Tat and for the reactivation of proviral expression from HIV-1 latently infected cells
25673149 The miR-199a/Brm/EGR1 axis is a determinant of anchorage-independent growth in epithelial tumor cell lines
25496315 We report, for the first time, co-inactivation and frequent mutations of SMARCB1, SMARCA2 and PBRM1 in MRTs.
25169058 Phenotype and genotype in Nicolaides-Baraitser syndrome patients with SMARCA2 mutations
25081545 BAF complex gene SMARCA2 is mutated in Coffin-Siris syndrome patients.
25026375 Over-expression of BRM in melanoma cells that harbor oncogenic BRAF promoted changes in cell cycle progression and apoptosis consistent with a tumor suppressive role.
24913006 these data show that the mechanism of BRM silencing contributes to the pathogenesis of Rhabdoid tumors
24520176 Depletion of BRM in BRG1-deficient cancer cells leads to a cell cycle arrest, induction of senescence, and increased levels of global H3K9me3.
24519853 Findings suggest that the BRM promoter double insertion homozygotes may be associated with an increased risk of early-stage UADT cancers independent of smoking status and histology.
24471421 loss of BRM expression is a common feature among poorly differentiated tumours in clear cell renal cell carcinomas. We hypothesize that loss of BRM expression is involved in tumor de-differentiation in clear cell RCCs.
24421395 A SMARCA2-containing residual SWI/SNF complex underlies the oncogenic activity of SMARCA4 mutant cancers.
23963727 Data suggest that Brg1 and Brm integrate various proinflammatory cues into cell adhesion molecule transactivation in endothelial injury.
23897427 Data indicate that transient knockdown of BRG1 or BRM reduces hypoxia induction of several known HIF1 and HIF2 target genes in Hep3B cells.
23872584 High SMARCA2 expression is associated with lung cancer
23770848 loss of BRM epigenetically induces C/EBPbeta transcription, which then directly induces alpha5 integrin transcription to promote the malignant behavior of mammary epithelial cells
23524580 the mitogen-activated protein kinase pathway regulates both BRM acetylation and BRM silencing as MAP kinase pathway inhibitors both induced BRM as well as caused BRM deacetylation.
23359823 findings suggest that BRM promoter polymorphism (BRM-1321) could regulate BRM expression and may serve as a potential marker for genetic susceptibility to HCC
23322154 BRM expression was lost in 25% of cell lines and 16% of tumors.
23276717 SMARCA2 rs2296212 and rs4741651 variants were associated with oligodendroglioma risk.
23163725 Loss of BRG1 and BRM was frequent in E-cadherin-low, TTF-1-low, and vimentin-high cases.
23088494 Reduced expression of BRM may contribute to the carcinogenesis of hepatocellular carcinoma.
22944692 Brm-type SWI/SNF chromatin remodeling complex is required for the occasional transcriptional elongation of the HIV-1 provirus in the absence of Tat and for the reactivation of proviral expression from HIV-1 latently infected cells
22721696 SWI/SNF chromatin remodeling complex catalytic subunits Brg1 and Brm modulate cisplatin cytotoxicity by facilitating efficient repair of the cisplatin DNA lesions.
22366787 sequenced the exomes of ten individuals with Nicolaides-Baraitser syndrome and identified heterozygous variants in SMARCA2 in eight of them.
21646426 multiple distinct transcriptional patterns of GR and Brm interdependence
21189327 results reveal that miR-199a and Brm form a double-negative feedback loop through Egr1, leading to the generation of two distinct cell types during carcinogenesis.
21092585 The expression of BRG1 and BRM correlates with the development of prostatic cancer.
21079652 The hBrm/Brg1 switch is an indicator of the responsiveness of a gene to heat-shock or IFNgamma stimulation and may represent an "on-off switch" of gene expression in vivo.
21070662 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20719309 The methylation levels of CpG islands within Brahma increased during spermatogenesis and decreased during oogenesis
20460684 REQ functions as an efficient adaptor protein between the SWI/SNF complex and RelB/p52 and plays important roles in noncanonical NF-kappaB transcriptional activation and its associated oncogenic activity.
20457675 The SWI/SNF chromatin-remodelin complex asa key component of the genetic architecture of schizophrenia.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20333683 Knockdown of either BRM or BRG1 resulted in an inhibition of cell proliferation in monolayer cultures.
20011120 show that SWI/SNF activity favors (from subunits Brg1/Brm) loading of HP1 proteins to chromatin both in vivo and in vitro
19784067 Data suggest that heterogeneous SWI/SNF complexes composed of either the BRG1 or BRM subunit promote expression of distinct and overlapping MITF target genes.
19726504 Brm-type SWI/SNF chromatin remodeling complex is required for the occasional transcriptional elongation of the HIV-1 provirus in the absence of Tat and for the reactivation of proviral expression from HIV-1 latently infected cells
19488910 Loss of heterozygosity at the 9p21-24 region and identification of BRM as a candidate tumor suppressor gene in head and neck squamous cell carcinoma.
19371634 Cdx2 regulates intestinal villin expression through recruiting Brm-type SWI/SNF complex to the villin promoter.
19363039 A missense polymorphism (rs2296212)induced a lower nuclear localization of BRM was associated with low SMARCA2 expression in the postmortem prefrontal cortex of schizophrenia patients.
19183483 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19144648 BRM and BRG1 SWI/SNF complexes have roles in differentiation
18923443 Hotspot mutation of Brahma in non-melanoma skin cancer.
18660489 Observational study of gene-disease association. (HuGE Navigator)
18082132 C/EBPbeta and GATAs may developmentally regulate the expression of brm by mutually exclusive binding.
18042045 at the TERT gene locus in human tumour cells containing a functional SWI/SNF complex, Brm, and possibly BRG1, in concert with p54(nrb), would initiate efficient transcription and could be involved in the subsequent splicing of TERT transcripts
18006815 Brm is required for villin expression, a definitive marker of intestinal metaplasia and differentiation
17938176 p53 activity is differentially regulated by Brm- and Brg1-containing SWI/SNF chromatin remodeling complexes
17546055 Loss of BRM through epigenetic silencing is associated with neoplasms
17075831 Aberrant expression of BRM genes is associated with disease development and progression in prostate cancers.
16749937 Observational study of gene-disease association. (HuGE Navigator)
16749937 family-based and case-control association study suggest that there is no association between the trinucleotide repeat polymorphism within SMARCA2 and schizophrenia
16601680 Brm-type SWI/SNF chromatin remodeling complex is required for the occasional transcriptional elongation of the HIV-1 provirus in the absence of Tat and for the reactivation of proviral expression from HIV-1 latently infected cells
16341228 on genes regulated by SWI/SNF, Brm contributes to the crosstalk between transcription and RNA processing by decreasing RNAPII elongation rate and facilitating recruitment of the splicing machinery to variant exons with suboptimal splice sites
15240517 BRM and BRG1 participate in two distinct chromosome remodeling complexes that are functionally complementary in non-small cell lung cancer
14657023 Cell culture in the presence of HDAC inhibitors facilitates the isolation of clones overexpressing Brm.
12620226 BRG1 and BRM complexes may direct distinct cellular processes by recruitment to specific promoters through protein-protein interactions that are unique to each ATPase.
12566296 This report provides supportive evidence that BRG1 and BRM act as tumor suppressor proteins and implicates a role for their loss in the development of non-small cell lung cancers.
12493776 human adrenal carcinoma cells can spontaneously transition between two subtypes by switching expression of BRG1 and Brm at the post-transcriptional level
11850427 Brm-containing SWI/SNF complex subfamily (trithorax-G) and a complex including YY1 and HDACs (Polycomb-G) counteract each other to maintain transcription of exogenously introduced genes
11719516 Brm could also drive expression of CD44; Brm can compensate for BRG-1 loss as pertains to RB sensitivity

AA Sequence

MSTPTDPGAMPHPGPSPGPGPSPGPILGPSPGPGPSPGSVHSMMGPSPGPPSVSHPMPTMGSTDFPQEGM      1 - 70
HQMHKPIDGIHDKGIVEDIHCGSMKGTGMRPPHPGMGPPQSPMDQHSQGYMSPHPSPLGAPEHVSSPMSG     71 - 140
GGPTPPQMPPSQPGALIPGDPQAMSQPNRGPSPFSPVQLHQLRAQILAYKMLARGQPLPETLQLAVQGKR    141 - 210
TLPGLQQQQQQQQQQQQQQQQQQQQQQQPQQQPPQPQTQQQQQPALVNYNRPSGPGPELSGPSTPQKLPV    211 - 280
PAPGGRPSPAPPAAAQPPAAAVPGPSVPQPAPGQPSPVLQLQQKQSRISPIQKPQGLDPVEILQEREYRL    281 - 350
QARIAHRIQELENLPGSLPPDLRTKATVELKALRLLNFQRQLRQEVVACMRRDTTLETALNSKAYKRSKR    351 - 420
QTLREARMTEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVAGKIQKLSKAVATWHANTERE    421 - 490
QKKETERIEKERMRRLMAEDEEGYRKLIDQKKDRRLAYLLQQTDEYVANLTNLVWEHKQAQAAKEKKKRR    491 - 560
RRKKKAEENAEGGESALGPDGEPIDESSQMSDLPVKVTHTETGKVLFGPEAPKASQLDAWLEMNPGYEVA    561 - 630
PRSDSEESDSDYEEEDEEEESSRQETEEKILLDPNSEEVSEKDAKQIIETAKQDVDDEYSMQYSARGSQS    631 - 700
YYTVAHAISERVEKQSALLINGTLKHYQLQGLEWMVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHK    701 - 770
RLNGPYLIIVPLSTLSNWTYEFDKWAPSVVKISYKGTPAMRRSLVPQLRSGKFNVLLTTYEYIIKDKHIL    771 - 840
AKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRILLTGTPLQNKLPELWALLNFLLPTIFKSCSTFE    841 - 910
QWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSALQKILYRH    911 - 980
MQAKGILLTDGSEKDKKGKGGAKTLMNTIMQLRKICNHPYMFQHIEESFAEHLGYSNGVINGAELYRASG    981 - 1050
KFELLDRILPKLRATNHRVLLFCQMTSLMTIMEDYFAFRNFLYLRLDGTTKSEDRAALLKKFNEPGSQYF   1051 - 1120
IFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKY   1121 - 1190
KLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEENEEEDEVPDDETLNQMIARREEEFDLFMRMDMDR   1191 - 1260
RREDARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKIFGRGSRQRRDVDYSDALTEKQWLRAIE   1261 - 1330
DGNLEEMEEEVRLKKRKRRRNVDKDPAKEDVEKAKKRRGRPPAEKLSPNPPKLTKQMNAIIDTVINYKDR   1331 - 1400
CNVEKVPSNSQLEIEGNSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLGDLEKD   1401 - 1470
VMLLCHNAQTFNLEGSQIYEDSIVLQSVFKSARQKIAKEEESEDESNEEEEEEDEEESESEAKSVKVKIK   1471 - 1540
LNKKDDKGRDKGKGKKRPNRGKAKPVVSDFDSDEEQDEREQSEGSGTDDE                       1541 - 1590
//

Text Mined References (118)

PMID Year Title
26564006 2016 Concomitant loss of SMARCA2 and SMARCA4 expression in small cell carcinoma of the ovary, hypercalcemic type.
26551623 2016 SWI/SNF Complex-deficient Undifferentiated/Rhabdoid Carcinomas of the Gastrointestinal Tract: A Series of 13 Cases Highlighting Mutually Exclusive Loss of SMARCA4 and SMARCA2 and Frequent Co-inactivation of SMARCB1 and SMARCA2.
26356327 2016 Dual loss of the SWI/SNF complex ATPases SMARCA4/BRG1 and SMARCA2/BRM is highly sensitive and specific for small cell carcinoma of the ovary, hypercalcaemic type.
25808524 2015 The SWI/SNF ATPases Are Required for Triple Negative Breast Cancer Cell Proliferation.
25673149 2015 The miR-199a/Brm/EGR1 axis is a determinant of anchorage-independent growth in epithelial tumor cell lines.
25496315 2015 Frequent co-inactivation of the SWI/SNF subunits SMARCB1, SMARCA2 and PBRM1 in malignant rhabdoid tumours.
25416956 2014 A proteome-scale map of the human interactome network.
25335168 2014 Common variants at 1p36 are associated with superior frontal gyrus volume.
25169058 2014 Phenotype and genotype in Nicolaides-Baraitser syndrome.
25081545 2014 Numerous BAF complex genes are mutated in Coffin-Siris syndrome.
25026375 2014 Modulation of Brahma expression by the mitogen-activated protein kinase/extracellular signal regulated kinase pathway is associated with changes in melanoma proliferation.
24913006 2014 The silencing of the SWI/SNF subunit and anticancer gene BRM in Rhabdoid tumors.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
24520176 2014 Functional epigenetics approach identifies BRM/SMARCA2 as a critical synthetic lethal target in BRG1-deficient cancers.
24519853 2014 Two BRM promoter insertion polymorphisms increase the risk of early-stage upper aerodigestive tract cancers.
24471421 2014 Loss of BRM expression is a frequently observed event in poorly differentiated clear cell renal cell carcinoma.
24421395 2014 Residual complexes containing SMARCA2 (BRM) underlie the oncogenic drive of SMARCA4 (BRG1) mutation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24025145 2013 A genome-wide association study of chemotherapy-induced alopecia in breast cancer patients.
23963727 2013 Proinflammatory stimuli engage Brahma related gene 1 and Brahma in endothelial injury.
23897427 2013 BRG1 and BRM chromatin-remodeling complexes regulate the hypoxia response by acting as coactivators for a subset of hypoxia-inducible transcription factor target genes.
23872584 2013 A synthetic lethality-based strategy to treat cancers harboring a genetic deficiency in the chromatin remodeling factor BRG1.
23770848 2014 Oncogenic targeting of BRM drives malignancy through C/EBP?-dependent induction of ?5 integrin.
23524580 2014 Identifying targets for the restoration and reactivation of BRM.
23453885 2013 Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.
23359823 2013 Insertion/deletion polymorphisms in the promoter region of BRM contribute to risk of hepatocellular carcinoma in Chinese populations.
23322154 2013 Association of two BRM promoter polymorphisms with head and neck squamous cell carcinoma risk.
23276717 2013 SWI/SNF gene variants and glioma risk and outcome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23163725 2013 Lung cancer with loss of BRG1/BRM, shows epithelial mesenchymal transition phenotype and distinct histologic and genetic features.
23088494 2013 Alterations of the SWI/SNF chromatin remodelling subunit-BRG1 and BRM in hepatocellular carcinoma.
22721696 2012 Downregulation of SWI/SNF chromatin remodeling factor subunits modulates cisplatin cytotoxicity.
22426308 2012 Mutations affecting components of the SWI/SNF complex cause Coffin-Siris syndrome.
22368283 2012 Human PIH1 associates with histone H4 to mediate the glucose-dependent enhancement of pre-rRNA synthesis.
22366787 2012 Heterozygous missense mutations in SMARCA2 cause Nicolaides-Baraitser syndrome.
21646426 2011 The glucocorticoid receptor and the coregulator Brm selectively modulate each other's occupancy and activity in a gene-specific manner.
21269460 2011 Initial characterization of the human central proteome.
21189327 2011 MicroRNAs miR-199a-5p and -3p target the Brm subunit of SWI/SNF to generate a double-negative feedback loop in a variety of human cancers.
21092585 2010 [Expression of BRG1 and BRM proteins in prostatic cancer].
21079652 2010 A switch from hBrm to Brg1 at IFN?-activated sequences mediates the activation of human genes.
21070662 2010 Schizophrenia and vitamin D related genes could have been subject to latitude-driven adaptation.
20719309 2011 Methylation patterns of Brahma during spermatogenesis and oogenesis: potential implications.
20460684 2010 Requiem protein links RelB/p52 and the Brm-type SWI/SNF complex in a noncanonical NF-kappaB pathway.
20457675 2010 SMARCA2 and other genome-wide supported schizophrenia-associated genes: regulation by REST/NRSF, network organization and primate-specific evolution.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20333683 2010 SWI/SNF chromatin remodeling enzyme ATPases promote cell proliferation in normal mammary epithelial cells.
20111005 2010 Crosstalk between C/EBPbeta phosphorylation, arginine methylation, and SWI/SNF/Mediator implies an indexing transcription factor code.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20011120 2009 Interaction of HP1 and Brg1/Brm with the globular domain of histone H3 is required for HP1-mediated repression.
19784067 2010 Heterogeneous SWI/SNF chromatin remodeling complexes promote expression of microphthalmia-associated transcription factor target genes in melanoma.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19488910 2009 Loss of heterozygosity at the 9p21-24 region and identification of BRM as a candidate tumor suppressor gene in head and neck squamous cell carcinoma.
19371634 2009 Cdx2 and the Brm-type SWI/SNF complex cooperatively regulate villin expression in gastrointestinal cells.
19363039 2009 Involvement of SMARCA2/BRM in the SWI/SNF chromatin-remodeling complex in schizophrenia.
19183483 2009 Screening and association testing of common coding variation in steroid hormone receptor co-activator and co-repressor genes in relation to breast cancer risk: the Multiethnic Cohort.
19144648 2009 Antagonistic roles for BRM and BRG1 SWI/SNF complexes in differentiation.
18923443 2009 Hotspot mutation of Brahma in non-melanoma skin cancer.
18765789 2008 Regulation of muscle development by DPF3, a novel histone acetylation and methylation reader of the BAF chromatin remodeling complex.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18082132 2008 Differentiation-specific expression of chromatin remodeling factor BRM.
18042045 2008 Brm transactivates the telomerase reverse transcriptase (TERT) gene and modulates the splicing patterns of its transcripts in concert with p54(nrb).
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18006815 2007 Frequent loss of Brm expression in gastric cancer correlates with histologic features and differentiation state.
17984088 2008 Dual role of NRSF/REST in activation and repression of the glucocorticoid response.
17938176 2007 The activity of p53 is differentially regulated by Brm- and Brg1-containing SWI/SNF chromatin remodeling complexes.
17546055 2007 The reversible epigenetic silencing of BRM: implications for clinical targeted therapy.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17075831 2007 Aberrant expression of SWI/SNF catalytic subunits BRG1/BRM is associated with tumor development and increased invasiveness in prostate cancers.
16916647 2006 Substrate and functional diversity of lysine acetylation revealed by a proteomics survey.
16749937 2006 Association study of the trinucleotide repeat polymorphism within SMARCA2 and schizophrenia.
16601680 2006 Requirement for SWI/SNF chromatin-remodeling complex in Tat-mediated activation of the HIV-1 promoter.
16341228 2006 The human SWI/SNF subunit Brm is a regulator of alternative splicing.
16097034 2005 Global phosphoproteome analysis on human HepG2 hepatocytes using reversed-phase diagonal LC.
15774904 2005 Activation of ATP-binding cassette transporter A1 transcription by chromatin remodeling complex.
15696166 2005 Brahma links the SWI/SNF chromatin-remodeling complex with MeCP2-dependent transcriptional silencing.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15240517 2004 Chromatin remodeling factors and BRM/BRG1 expression as prognostic indicators in non-small cell lung cancer.
15164053 2004 DNA sequence and analysis of human chromosome 9.
15107404 2004 Liver tumors escape negative control of proliferation via PI3K/Akt-mediated block of C/EBP alpha growth inhibitory activity.
15075294 2004 TopBP1 recruits Brg1/Brm to repress E2F1-induced apoptosis, a novel pRb-independent and E2F1-specific control for cell survival.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14701856 2004 Transcription factors and nuclear receptors interact with the SWI/SNF complex through the BAF60c subunit.
14660596 2004 The CCAAT enhancer-binding protein alpha (C/EBPalpha) requires a SWI/SNF complex for proliferation arrest.
14657023 2003 Growth inhibition by the mammalian SWI-SNF subunit Brm is regulated by acetylation.
14603256 2003 Conserved SNH domain of the proto-oncoprotein SYT interacts with components of the human chromatin remodelling complexes, while the QPGY repeat domain forms homo-oligomers.
12757710 2003 Aging reduces proliferative capacities of liver by switching pathways of C/EBPalpha growth arrest.
12620226 2003 Transcriptional specificity of human SWI/SNF BRG1 and BRM chromatin remodeling complexes.
12566296 2003 Loss of BRG1/BRM in human lung cancer cell lines and primary lung cancers: correlation with poor prognosis.
12493776 2003 SW13 cells can transition between two distinct subtypes by switching expression of BRG1 and Brm genes at the post-transcriptional level.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12437990 2002 Brain-specific expression of the nuclear actin-related protein ArpNalpha and its involvement in mammalian SWI/SNF chromatin remodeling complex.
12200431 2002 Largest subunits of the human SWI/SNF chromatin-remodeling complex promote transcriptional activation by steroid hormone receptors.
12065415 2002 Prohibitin requires Brg-1 and Brm for the repression of E2F and cell growth.
12044884 2002 A putative nuclear receptor coactivator (TMF/ARA160) associates with hbrm/hSNF2 alpha and BRG-1/hSNF2 beta and localizes in the Golgi apparatus.
11734557 2002 SYT associates with human SNF/SWI complexes and the C-terminal region of its fusion partner SSX1 targets histones.
11719516 2002 Compensation of BRG-1 function by Brm: insight into the role of the core SWI-SNF subunits in retinoblastoma tumor suppressor signaling.
11262242 2001 The domino gene of Drosophila encodes novel members of the SWI2/SNF2 family of DNA-dependent ATPases, which contribute to the silencing of homeotic genes.
11175787 2001 Mammalian SWI/SNF complexes promote MyoD-mediated muscle differentiation.
11134956 2001 Expression of chromatin remodeling factors during neural differentiation.
11078522 2000 The human SWI/SNF-B chromatin-remodeling complex is related to yeast rsc and localizes at kinetochores of mitotic chromosomes.
10938115 2000 Octamer transfer and creation of stably remodeled nucleosomes by human SWI-SNF and its isolated ATPases.
10910076 2000 Proliferation-associated SNF2-like gene (PASG): a SNF2 family member altered in leukemia.
10078207 1999 Reconstitution of a core chromatin remodeling complex from SWI/SNF subunits.
10072425 1999 Functional domains of the SYT and SYT-SSX synovial sarcoma translocation proteins and co-localization with the SNF protein BRM in the nucleus.
9710619 1998 A human RNA polymerase II complex containing factors that modify chromatin structure.
9099865 1997 Ligand-dependent interaction between the estrogen receptor and the human homologues of SWI2/SNF2.
8895581 1996 Purification and biochemical heterogeneity of the mammalian SWI-SNF complex.
8804307 1996 Diversity and specialization of mammalian SWI/SNF complexes.
8670841 1996 The hbrm and BRG-1 proteins, components of the human SNF/SWI complex, are phosphorylated and excluded from the condensed chromosomes during mitosis.
8223438 1993 A human homologue of Saccharomyces cerevisiae SNF2/SWI2 and Drosophila brm genes potentiates transcriptional activation by the glucocorticoid receptor.
8208605 1994 Two human homologues of Saccharomyces cerevisiae SWI2/SNF2 and Drosophila brahma are transcriptional coactivators cooperating with the estrogen receptor and the retinoic acid receptor.
8012116 1994 Assignment of HBRM, the human homolog of S. cerevisiae SNF2/SWI2 and Drosophila brm genes, to chromosome region 9p23-p24, by in situ hybridization.
7565614 1995 A fission yeast gene mapping close to suc1 encodes a protein containing two bromodomains.