Property Summary

NCBI Gene PubMed Count 30
PubMed Score 220.29
PubTator Score 21.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Protein-protein Interaction (6)

Gene RIF (12)

PMID Text
26122142 Case Report: hamartomatous olyposis and gastrointestinal ganglioneuromas with SMAD9 germline mutation that reduces PTEN expression.
24008158 HIV-1 Tat-treated pulmonary arterial smooth muscle cells modulate levels of phosphorylated SMAD1/5/8 proteins and SMAD1/5/8-SMAD4 protein complex, which are repressed by cocaine exposure
23804438 a detailed computational model for TGF-beta signalling that incorporates elements of previous models together with crosstalking between Smad1/5/8 and Smad2/3 channels through a negative feedback loop dependent on Smad7.
23384547 ATP production by NaF promotes hypertrophy-like changes via activation of phospho-Smad8
22897816 TNF activated NF-kappaB pathway and inhibited the phosphorylation of Smad 1/5/8 and BMP-2-induced osteoblastic differentiation in BMMSCs
22707059 CREBZF, a novel Smad8-binding protein.
22452883 Data suggest that Smads 1, 5 and 8 as potential prognostic markers and therapeutic targets for mTOR inhibition therapy of prostate cancer.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19269967 increases of p16(INK4a) and p21(WAF1/cip1) expression in response to BMP4 were mediated by the Smad1/5/8 signaling pathway.
19244313 5-HT transactivates the serine kinase receptor, BMPR 1A, to activate Smads 1/5/8 via Rho and Rho kinase in in bovine and human pulmonary artery smooth muscle cells
19211612 Study described the first mutation in SMAD8 in a patient with IPAH, and suggested the involvement of SMAD8 in the pathogenesis of PAH.
18775991 Endoglin promotes transforming growth factor beta-mediated Smad 1/5/8 signaling and inhibits endothelial cell migration through its association with GIPC

AA Sequence

MHSTTPISSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDSLVKKLKKKKGAMDELERALSCPGQPSKCVT      1 - 70
IPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYRRVETPVLP     71 - 140
PVLVPRHSEYNPQLSLLAKFRSASLHSEPLMPHNATYPDSFQQPPCSALPPSPSHAFSQSPCTASYPHSP    141 - 210
GSPSEPESPYQHSVDTPPLPYHATEASETQSGQPVDATADRHVVLSIPNGDFRPVCYEEPQHWCSVAYYE    211 - 280
LNNRVGETFQASSRSVLIDGFTDPSNNRNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECV    281 - 350
SDSSIFVQSRNCNYQHGFHPATVCKIPSGCSLKVFNNQLFAQLLAQSVHHGFEVVYELTKMCTIRMSFVK    351 - 420
GWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS                           421 - 467
//

Text Mined References (31)

PMID Year Title
26122142 2015 Exome Sequencing Reveals Germline SMAD9 Mutation That Reduces Phosphatase and Tensin Homolog Expression and Is Associated With Hamartomatous Polyposis and Gastrointestinal Ganglioneuromas.
23804438 2013 Computational modelling of Smad-mediated negative feedback and crosstalk in the TGF-? superfamily network.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23384547 2013 Impaired glycolytic metabolism causes chondrocyte hypertrophy-like changes via promotion of phospho-Smad1/5/8 translocation into nucleus.
22897816 2013 Activated NF-?B in bone marrow mesenchymal stem cells from systemic lupus erythematosus patients inhibits osteogenic differentiation through downregulating Smad signaling.
22707059 2012 CREBZF, a novel Smad8-binding protein.
22452883 2012 Inhibition of mTORC1 kinase activates Smads 1 and 5 but not Smad8 in human prostate cancer cells, mediating cytostatic response to rapamycin.
21898662 2011 Molecular genetic characterization of SMAD signaling molecules in pulmonary arterial hypertension.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19269967 2009 BMP4-Smad signaling pathway mediates adriamycin-induced premature senescence in lung cancer cells.
19244313 2009 Serotonin induces Rho/ROCK-dependent activation of Smads 1/5/8 in pulmonary artery smooth muscle cells.
19211612 2009 A new nonsense mutation of SMAD8 associated with pulmonary arterial hypertension.
19018011 2008 Holding their own: the noncanonical roles of Smad proteins.
18775991 2008 Endoglin promotes transforming growth factor beta-mediated Smad 1/5/8 signaling and inhibits endothelial cell migration through its association with GIPC.
17356069 2007 Endofin acts as a Smad anchor for receptor activation in BMP signaling.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15621726 2004 Bone morphogenetic proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14687659 2004 Signal transduction of bone morphogenetic protein receptors.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11121043 2000 Ski represses bone morphogenic protein signaling in Xenopus and mammalian cells.
10708949 TGF-beta signaling by Smad proteins.
10708948 The Smad pathway.
10647776 Remarkable versatility of Smad proteins in the nucleus of transforming growth factor-beta activated cells.
10583507 1999 Smad8B, a Smad8 splice variant lacking the SSXS site that inhibits Smad8-mediated signalling.
9759503 1998 TGF-beta signal transduction.
9436979 1998 Smad6 inhibits BMP/Smad1 signaling by specifically competing with the Smad4 tumor suppressor.
9256479 1997 Vascular MADs: two novel MAD-related genes selectively inducible by flow in human vascular endothelium.
9205116 1997 Cloning and characterization of a novel member of the human Mad gene family (MADH6).