Property Summary

NCBI Gene PubMed Count 364
PubMed Score 1084.96
PubTator Score 517.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.563 1.5e-02
Multiple myeloma 1.192 3.0e-02
psoriasis 1.100 1.3e-02
group 3 medulloblastoma 1.400 1.4e-04
primitive neuroectodermal tumor 1.400 9.9e-05
Amyotrophic Lateral Sclerosis 1.118 9.8e-06
lung cancer 1.500 2.8e-02
Breast cancer 2.400 2.8e-02
subependymal giant cell astrocytoma 1.073 3.5e-02
ovarian cancer 2.100 1.6e-04
pituitary cancer 1.200 1.6e-05
dermatomyositis 1.300 1.4e-03

Gene RIF (223)

PMID Text
26974954 data suggest that TGF-beta1 enhances IGFBP7 via Smad2/4 pathways, and that IGFBP7 might be involved in the TGF-beta1-induced tubular injury in DN.
26802603 Smad2 enhances TRAIL-induced apoptosis in activated hepatic stellate cells, which facilitates the resolution of hepatic fibrosis
26708185 correlation between TGFb1 and pSmad2 as well as between HtrA1 and TGFb1 and the very significant increase of Ki67 in stromal compartment of eutopic endometrium suggest a possible involvement of HtrA1 in the pathogenesis of endometriosis.
26680585 Data suggest SHC1 (SH2 domain protein C1) expression down-regulates epithelial-mesenchymal transition by repressing TGFB-induced SMAD2/3 activation through differential partitioning of receptors at cell surface of mammocytes/keratinocytes.
26674378 MiR-425 functions as an oncogene by targeting the 3'-UTR of SMAD2 in esophageal squamous cell carcinoma.
26647993 The present study thus proposed SEB as an agent able to significantly reduce Smad2/3 expression in colon cancer cells, provoking moderate TGFb growth signaling and the reduction of tumor cell proliferation.
26608417 Suggest that greater tumor associated macrophage density, strong Hexim1 expression, strong SMAD2 expression, and mild SMAD7 expression play important roles in the progression of prostate adenocarcinoma.
26445225 TGF-beta/Smad signalling pathway and VEGF-A participate in the pathogenesis of sarcoidosis.
26384307 Up-regulation of smad2 is associated with endometrial cancer.
26383977 Relationship between Expression of TGF-beta1, Smad2, Smad4 and Prognosis of Patients with Resected Non-small Cell Lung Cancer
26365350 Follistatin-like 1 attenuates differentiation and survival of erythroid cells through Smad2/3 signaling.
26265084 Different signaling pathways are involved in osteitis in CRS and are activated by the TGF-beta/Smad signaling pathway in CRSwNP versus the TGF-beta/Smad-independent signaling pathway in CRSsNP.
26261683 Suggest that TGF-beta1/Smad and Wnt/CTNNB1 signaling pathways both contribute to pathological scar formation.
26261569 Astragaloside can delay the renal fibrosis process in diabetic mice by influencing the TGF-beta/SMADS signaling pathway and down-regulating TGF-beta1, SMAD2/3, and alpha-SMA expression.
26247899 SMAD2 mutations are associated with arterial aneurysms and dissections
26150340 we show, for the first time, that SMAD2 signaling is directly regulated by HDAC6
26057631 Studies demonstrated that MUC1-mediated JNK activation not only enhances the phosphorylation of Smad2 C-terminal at Ser-465/467 site (Smad2C) through TGF-beta/TbetaRI, but also enhances the phosphorylation of Smad2 linker region at Ser-245/250/255 site.
26045877 Neovibsanin B utilizes the canonical Smad signalling pathway to stimulate ECM synthesis in human optic nerve head cells.
25988335 study indicated that miR-212/132 functions as tumor suppressor by targeting SMAD2 in cervical cancer
25980495 Report inhibition of colorectal cancer stem cell survival and invasive potential by hsa-miR-140-5p mediated suppression of Smad2 and autophagy.
25971746 These findings uncover a plausible mechanism for NF-kappaB-sustained TGF-beta/Smad activation via miR-148a in glioblastoma.
25921273 Induction of neural crest genes by beta-catenin is repressed by SMAD2/SMAD3, ensuring proper lineage specification.
25891879 the findings of the present study suggest that H2O2 contributes to HUVEC apoptosis by inducing Nox4-dependent ROS aggregation and activating the TGF-beta1/Smad2 signaling pathway.
25882870 smad2 and Erk/Akt have roles in TGF-beta1-induced apoptosis in human gingival epithelial cells
25843708 DEANR1 facilitates FOXA2 activation by facilitating SMAD2/3 recruitment to the FOXA2 promoter
25701598 TGF-beta/Smad2/Smad3 signal pathway is involved in glioma tumor cells proliferation and apoptosis.
25586740 MicroRNA-10a silencing reverses cisplatin resistance in the A549/cisplatin human lung cancer cell line via the transforming growth factor-beta/Smad2/STAT3/STAT5 pathway
25557170 Nodal induces signal transduction through the Smad2/3-dependent pathway in vitro. Results that Nodal promotes pancreatic cancer cell migration and invasion and induces epithelial-mesenchymal transition.
25542272 A cytoplasmic predominant TGF-betaRII expression pattern and a higher pSmad2 expression were associated with decreased breast cancer survival.
25477335 Together, our findings defined an essential role for the KMT1E/SMAD2/3 repressor complex in TGFbeta-mediated lung cancer metastasis.
25476248 Ca2+- and KCa3.1-dependent processes facilitate "constitutive" alpha smooth muscle actin expression and Smad2/3 signalling in IPF-derived fibroblasts, and thus promote fibroblast to myofibroblast differentiation.
25373709 High p-Smad2 expression in stromal fibroblasts is associated with non-small cell lung cancer.
25351340 knockdown of Smad3 significantly reduced TGF-beta1-induced Col.I production. These findings were further evident by the results that overexpression of Smad2 attenuated the expression of Col.I and TIMP-1
25342595 We found that induction of SMAD2 in HCC cells completely abolished the inhibitory effect of NH4Cl on rapamycin-induced autophagy in HCC cells, suggesting that NH4Cl inhibits autophagy of HCC cells through inhibiting SMAD2 signaling.
25304053 Lefty reduced the levels of phosphorylated Smad2, Smad3, and ERK1/2, inhibited the proliferation and invasion of glioma cells, and increased their apoptosis.
25232019 A role for decorin and p-Smad-2 in the pathophysiology of fetal membranes and adverse pregnancy outcomes.
25207745 The expression levels of collagens type I/III, TGF-beta1, Smad2/3/4/7 and PAI-1 (plasminogen activator inhibitor type 1) in gluteal muscle contraction (GMC) patients were measured.
25198664 miR-136 may play a tumor-suppressive role by repressing EMT and prometastatic traits via targeting Smad2 and Smad3.
25166914 Study has revealed miR-27a as a tumor suppressor and has identified SGPP1 and Smad2 as novel targets of miR-27a, linking to STAT3 for regulating cancer cell proliferation, apoptosis and migration in colorectal cancer.
25105734 Activin A, B, and AB produce comparable increases in human trophoblast cell invasion by up-regulating N-cadherin expression in a SMAD2/3-SMAD4-dependent manner.
24925688 In conclusion, this study identifies opposing roles for Smad2 and Smad3 in peritoneal dialysis-associated peritoneal fibrosis
24911914 Smad2 and Smad3 are both necessary for the formation of posterior capsular opacification of human lens epithelial cells.
24892945 The current findings indicate miR-146a plays an important role in skeletogenesis through attenuation of SMAD2 and SMAD3 function.
24788939 Data suggest that extracellular signal-regulated kinases ERK1/2 signaling can cross-interact with the transforming growth factor beta2/Smad2/3 and the Jagged-1/Notch-3 signaling in retinal pigment epithelium cells epithelial-mesenchymal transition.
24771066 These results suggest that ZNF580 mediates eNOS expression and endothelial cell migration/proliferation via the TGF-b1/ALK5/Smad2 pathway, and thus plays a crucial role in vascular endothelial cells.
24717670 Mutations in SMAD2 may be a cause of as much as 10% of all congenital heart disease.
24696849 Nodal promotes the self-renewal of human colon cancer stem cells and mediate carcinogenesis of human colorectal cancer via an autocrine manner through Smad2/3 pathway.
24664294 Data indicate that miR-18a could regulate trophoblast Cell invasion via targeting Smad2.
24613014 data suggest that PGE2 had no effects on Smad2 phosphorylation, suggesting that PGE2-mediated Smad2-Smad4 complex formation is independent of TGF-beta signaling
24530353 Respiratory exposure to multi-walled carbon nanotubes induced length dependent pulmonary fibrosis and epithelial-derived fibroblasts via TGF-beta1/Smad2 pathway.
24503541 Galectin-1 stimulates motility of human umbilical cord blood-derived mesenchymal stem cells by downregulation of smad2/3-dependent COL3A1/COL5A1 and upregulation of NF-kappaB-dependent fibronectin/laminin 5 expression.
24477908 Using a human CTL system model based on a CD8(+)/CD103(-) T cell clone specific of a lung tumor-associated Ag, we demonstrated that the transcription factors Smad2/3 and NFAT-1 are two critical regulators of this process.
24427302 High expression of IGFBP7 in fibroblasts induced by colorectal cancer cells is co-regulated by TGF-beta and Wnt signaling in a Smad2/3-Dvl2/3-dependent manner.
24394555 Phosphorylated Smad2 is enriched in recurrent compared with matched-primary ovarian tumors.
24370825 Nodal expression was significantly upregulated in glioma cells when TGF-beta was added, whereas the TGF-beta-induced Nodal expression was evidently inhibited by transfection Smad2 or Smad3 siRNAs.
24347165 Glucocorticoids recruit Tgfbr3 and Smad1 to shift transforming growth factor-beta signaling from the Tgfbr1/Smad2/3 axis to the Acvrl1/Smad1 axis in lung fibroblasts.
24269534 Smad2 promotes the tumor progression by upregulating the CDK2, CDK4, and cyclin E.
24183998 inhibition of Smad2/3 by siRNA significantly decreased the production of IL-6 and VEGF in mesenchymal stem cells and induced their osteogenic differentiation
24098582 TRPV1 potentiates TGFbeta-induction of corneal myofibroblast development through an oxidative stress-mediated p38-SMAD2 signaling loop.
24052079 Smad2 and PIAS1 proteins were significantly upregulated resulting in dramatically increased interactions between Smad2/4 and PIAS1 in the presence of zinc.
24008158 HIV-1 Tat-treated pulmonary arterial smooth muscle cells downregulate levels of phosphorylated SMAD2/3 proteins and SMAD2/3-SMAD4 protein complex, which are repressed by cocaine exposure
23929584 One SNP in the SMAD2 gene having association with chronic otitis media with effusion in study population.
23916701 miR-18b regulated the TGF-beta1-induced differentiation of miR-18b regulated the TGF-beta1-induced differentiation of hair follicle mesenchymal stem cells into smooth muscle cells by targeting SMAD2 gene.
23873106 Data show that miR-148a downregulated vimentin expression and upregulated E-cadherin expression, suggesting that miR-148a inhibited epithelial-mesenchymal transition (EMT), and the SMAD2 gene was identified as the direct and functional target of miR-148a.
23814118 Smad2 regulated protease nexin-1 up-regulation differentiates chronic aneurysm development from acute aortic dissection.
23804438 a detailed computational model for TGF-beta signalling that incorporates elements of previous models together with crosstalking between Smad1/5/8 and Smad2/3 channels through a negative feedback loop dependent on Smad7.
23779087 a nuclear envelope-localized mechanism of inactivating TGF-beta signaling in which MAN1 competes with transcription factors for binding to Smad2 and Smad3 and facilitates their dephosphorylation by PPM1A.
23747729 Smad2 is required for transcription of the aromatase gene in the KGN cells.
23738652 The signaling activation triggered by overexpression of Smad2 was dependent on TGF-beta type I receptor, increased p15 and p21 expression, responsible for inhibiting cell cycle entry, resulting in antiproliferative effects on gingival epithelial cells.
23666711 Context-dependent responses to Smad2/3 imposed by Polycomb action provide a mechanism for selective gene regulation that can reconcile the apparently conflicting roles of this signaling pathway in pluripotency, differentiation, and reprogramming.
23649632 Findings indicate that Smad2 is a unique integrator of transcription and signaling events and is essential for the maintenance of the mouse and human primed pluripotent stem cell state.
23591895 show that Araf antagonizes mesendoderm induction and patterning activity of Nodal/Smad2 signals in vertebrate embryos by directly inhibiting Smad2 signalling
23419524 SMAD2 and SMAD3 acetylatation by P300-CBP is mediated by TGFB1 in human lung cancer cells.
23297089 SDC-2 modulates TGFbeta2 transcriptional regulation via Smad2 signaling to facilitate fibrosarcoma cell adhesion.
23295196 increased activation in thoracic aortic aneurysms
23259454 Binding of Activin-A-responsive SMAD2 to the NKX2-1 promoter plays essential role during respiratory endoderm specification.
23139211 The prevalence of SMAD4, SMAD2, and SMAD3 mutations in sporadic CRCs was 8.6% (64 of 744), 3.4% (25 of 744), and 4.3% (32 of 744), respectively.
23077590 The non-canonical increase in Smad linker phosphorylation induced by riluzole could contribute to the modulation of the pro-oncogenic functions of Smad2 and Smad3 in late stage melanomas.
22999704 Diseased aortic valve leaflets demonstrated strong immunohistochemical staining for transforming growth factor-beta1 and phosphorylated Smad2/3.
22935165 Suggest that TGFbeta1/Smad2 signalling pathway of T cells is altered in patients with Behcet's disease.
22868198 Immunohistochemical analysis of phosphorylated Smad2 showed nuclear expression in 70% of the osteosarcoma samples at levels comparable to osteoblastoma. Cases with lower expression showed significantly worse disease free survival.
22710166 analysis of the dynamics of TGF-beta and Smad2/Smad3 signaling [review]
22705205 The TGF-beta-mediated regulation of CD36, lipoprotein lipase and scavenger receptor-A gene expression was dependent on Smad-2.
22617150 TGF-beta family signaling through Smads is conceptually a simple and linear signaling pathway, driven by sequential phosphorylation, with type II receptors activating type I receptors, which in turn activate R-Smads [review]
22563507 Data show that dSmad2 directly influences Baboon's phosphorylation of Mad.
22461896 Data suggest that the formation of transient TIF1gamma-Smad2-Smad4 ternary complexes is the only one that can account for TGF-beta signaling.
22426647 miR-155 may function as a tumor suppressor to regulate gastric cancer cell metastasis by targeting SMAD2, and its downregulation in gastric cancer cells may be partly ascribed to DNA methylation.
22385658 When PI3K/Akt signaling is low, Wnt effectors are activated and function in conjunction with Smad2,3 to promote differentiation
22301403 Smad2 copy-number variations are associated with basal cell carcinoma, squamous cell carcinoma in skin cancers.
22278155 Data suggest that TGF-beta, TGF-betaR1, TGF-betaR2, Smad4, pSmad2/3, and E-cadherin are closely related to tumor-node-metastasis (TNM) stage of colorectal cancer (CRC).
22228025 Both androgen-sensitive and castration-resistant prostate cancer cell lines demonstrate TGF-beta1-induced phosphorylation and nuclear translocation of Smad2/3 that is robust in metastatic lines.
21960005 Protein phosphatase PPM1A regulates the nuclear export of Smad2/3 through targeting nuclear exporter RanBP3.
21883378 we describe TGF-beta signalling through Smad2/3 and the importance of the linker region in the regulation and expression of genes induced by TGF-beta--{REVIEW}
21828274 HEB and E2A-bind the SCA motif at regions overlapping SMAD2/3 and FOXH1
21749466 In middle cerebral artery occlusion-induced activation of Smad-binding elements (SBEs), a downstream target of Smad 2/3 transcription factors regulates expression of the luciferase reporter.
21732483 specific inhibition of SMAD-2/3 signaling pathway in hESCs facilitates the conversion of hESCs into multipotent MSCs with fully immunosuppresive and anti-inflammatory properties in vivo, opening up new avenues for potential future clinical applications.
21646355 l type-specific target selection by combinatorial binding of Smad2/3 proteins and hepatocyte nuclear factor 4alpha in HepG2 cells.
21624123 In malignant cells with a functional TGF-beta signalling pathway Rac1 antagonizes the TGF-beta1 growth inhibitory response and enhances cell migration by antagonistically regulating Smad2 and Smad3 activation
21490324 Smad2 was both preferentially phosphorylated in the linker region and localized to the nucleus in a flow-dependent manner
21406405 Findings offer insights into how MNK1 pathways control translation of cancer-related mRNAs including SMAD2, a key component of the TGF-beta signaling pathway.
21377836 Activin A-ACVRIB/ALK4-Smad-dependent collagen production was augmented in SSc fibroblasts, suggesting the involvement of this signaling mechanism in systemic sclerosis.
21258410 Data show that the WWP2-N isoform interacts with Smad2 and Smad3, whereas WWP2-C interacts only with Smad7.
21170261 results indicate that the DeltaNp63 promoter is activated by the keratinocyte-specific TGF-beta signaling mechanism with Smad2 and IKKalpha in squamous cell carcinomas
21110833 The expression of p-Smad2 is associated with malignant phenotype and poor prognosis in patients with advanced gastric carcinoma.
21106222 A strong negative correlation between LTBP-1 and P-Smad2 immunoreactivity was found, implying that LTBP-1 is not likely to contribute directly to the increased levels of TGF-beta activity in malignant mesothelioma.
21095583 PARP-1 dissociates Smad complexes from DNA by ADP-ribosylating Smad3 and Smad4, which attenuates Smad-specific gene responses and TGF-beta-induced epithelial-mesenchymal transition.
21081648 These findings indicate that IKKalpha contributes to the tumor-promoting function of the TGFbeta-SMAD signaling pathway in particular cancers.
21068203 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
21052639 SMAD2 polymorphisms may be one of genetic determinants of BMD in postmenopausal women
21052639 Observational study of gene-disease association. (HuGE Navigator)
21036908 MicroRNA-155 has a role in targeting SMAD2 and modulating the response of macrophages to transforming growth factor-beta
20977504 The Smad2 was highly expressed in VKC conjunctiva in association with TGF-b1.
20954112 pattern of Smad2 activation supports a model in which TGFbeta/activin signaling is anti-atherogenic in the media of normal artery walls but is equally compatible with an anti-atherogenic or pro-atherogenic response to TGFbeta/activin in neointima of lesions.
20945383 Smad2/3 and p38 MAPK differentially regulate TGFB1-induced epithelial-mesenchymal transition in pulmonary epithelial cells.
20852387 Smad2 loss causes HGF upregulation via loss of Smad2-mediated transcriptional repression and enhanced Smad3/4-mediated transactivation.
20734064 Observational study of gene-disease association. (HuGE Navigator)
20717921 TGFbeta1-induced Smad2 nuclear translocation is negatively regulated by intracellular Ca(2+) in OLI-neu cells and increased intracellular Ca(2+) concentrations block Smad2-mediated transcription of TGFbeta target genes.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20607798 The Smad2/3 pathway is the predominant TGFbeta1 signaling pathway inducing Il6 and inhibiting Il8 release in bronchial epithelial cells.
20604712 Smad2 is rapidly phosphorylated by treatment with lipoic acid within 30 min, enhancing type I collagen synthesis through the activation of Smad signaling.
20462450 Smad6 together with Smad2 may be prognostic factors, independent of nodal status in oral SCC after curative resection
20460105 BMP6, Smad1, Smad2 mRNA and protein expression were significantly higher in during sickle-cell pathology with orthopedic complications.
20453000 Observational study of gene-disease association. (HuGE Navigator)
20350217 We assessed the immunohistochemical expression profiles of Smad2, P-Smad2, Smad4, and p21/WAF1 proteins in 34 cases of osteosarcoma
20347004 feasible route for lactoferrin to transduce its antiproliferative effect in HeLa cells
20346360 Observational study of gene-disease association. (HuGE Navigator)
20086175 Findings reveal a hyperactive TGFbeta-TGFbetaR-Smad2 signaling axis needed to maintain epigenetic silencing of critical EMT genes and breast cancer progression.
20011542 Of 51 microsatellite stable colon tumors, 7 (14%) lost ACVR2, 2 (4%) ACVR1, and 5 (10%) pSMAD2 expression.
20010874 Smad2 knockdown resulted in a more aggressive breast cancer cells.
19951945 Data show that upon hypoxia, the TGF-beta-induced phosphorylation of Smad3 was inhibited, although Smad2 remained phosphorylated, and Smad3 was dephosphorylated by PP2A.
19937272 Our data provide evidence that TGF-beta signaling patterns vary by age and pathologic features of prognostic significance including ER expression.
19917253 Results identify Nedd4L as the ubiquitin ligase in TGF-beta induced phosphorylation of the transcription factors Smad2 and Smad3.
19827952 TGF-beta-mediated up-regulation of the expression of the integrin subunits alpha(2) and alpha(6) is mainly mediated in MSC by Smad2.
19822523 p130Cas is required for mammary tumor growth and transforming growth factor-beta-mediated metastasis through regulation of Smad2/3 activity
19819941 Data suggest that the SMAD family, possibly through disruption of SMAD1/5 or activation of SMAD2/3 may contribute to the pathogenesis of JGCT in humans.
19751112 Myostatin or 20 ng/mL BMP-11 maintain the colony and cellular morphology of undifferentiated hESC, maintain POU5f1, NANOG, TRA-1-60, and SSEA4 expression, and display increased SMAD2/3 phosphorylation
19688145 Study data demonstrates downregulated SMAD2 expression in psoriatic skin.
19620243 SARA has a role in regulating cell phenotype and its effects are mediated through modification of the balance between Smad2 and Smad3 signaling
19558215 Study shows that Sp1 alone or the combination of Smad2 and Smad4 activated the alpha(1)(I) collagen promoter in transfected LX-2 stellate cells.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19429239 The results suggest that 15d-PGJ(2) inhibits TGF-beta-induced CTGF expression by inhibiting the phosphorylation of Smad2.
19421146 Results show that targeted disruption of the cell surface Cripto/GRP78 complex precludes Cripto activation of MAPK/PI3K and Smad2/3 pathways.
19420158 HIV-1 Tat-treated pulmonary arterial smooth muscle cells downregulate levels of phosphorylated SMAD2/3 proteins and SMAD2/3-SMAD4 protein complex, which are repressed by cocaine exposure
19397700 Ang II activation of Smad2 occurs via the AT1 receptor, but not the AT2 receptor
19351817 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19289081 RanBP3 directly recognizes dephosphorylated Smad2/3, which results from the activity of nuclear Smad phosphatases, and mediates nuclear export of Smad2/3 in a Ran-dependent manner.
19211612 Observational study of gene-disease association. (HuGE Navigator)
19201832 disruption of Smad2 function by CDK2 phosphorylation acts as a mechanism for TGF-beta resistance in multiple myeloma.
19122240 Pin1 negatively regulates TGF-beta signaling by down-regulating Smad2/3 protein levels via induction of Smurf2-mediated ubiquitin-proteasomal degradation.
19104148 Data suggest that integrin alpha3beta1 is a critical coordinator of epithelial-mesenchyme transition signaling pathways involving beta-catenin and pSmad2.
19066393 Single nucleotide polymorphism in SMAD2 gene is associated with acute lymphoblastic leukemia.
18983975 This study has demonstrated that constant cyclic stretching inhibits adipogenic differentiation of human umbilical cord progenitor cells via autocrine/paracrine stimulation of the TGFbeta1/Smad2 signaling pathway.
18955504 Binding elements for ETS and transcription factor AP-2 (TFAP2) were significantly enriched in Smad2/3 binding sites, and knockdown of either ETS1 or TFAP2A resulted in overall alteration of TGF-beta-induced transcription.
18949743 SMAD2 is not shown to have a role in colorectal cancer with inflammatory bowel disease
18949743 Observational study of gene-disease association. (HuGE Navigator)
18826955 Activin stimulates endogenous inhibin alpha- and betaB-subunit mRNA, protein, and proteolytic processing. Simultaneously, activin stimulated the proconvertase furin through a Smad2/3-dependent process.
18729074 a number of putative novel Smad2 and Smad3 associated proteins in TGF-beta1 signaling were identified that have functions in cell proliferation, apoptosis, actin cytoskeleton regulation, cell motility, transcription, and Ras or insulin signaling
18648910 the expression levels of TbetaRII and Smad2 in Sertoli Cell-Only Syndrome testes were upregulated compared to that in the normal controls.
18618014 Keratinocyte-specific SMAD2 ablation results in increased epithelial-mesenchymal transition during skin cancer formation and progression.
18616749 Compared with normal skin fibroblasts, endogenous expression of Smad2 in hypertrophic skin fibroblasts was up-regulated and TGF-beta1 could further stimulate the production of Smad2.
18568018 Data demonstrate that in response to TGFbeta stimulation the transcriptional regulator TAZ binds heteromeric Smad2/3-4 complexes and is recruited to TGFbeta response elements.
18511908 PCTA defines a new component of the TGF-beta signalling pathway that functions to facilitate Smad2 phosphorylation through controlling the accumulation of cPML into the cytoplasm, and consequently, the assembly of Smad2-receptor complex.
18482992 PTEN abrogates TGF-beta-induced Smad2/3 phosphorylation. This study establishes a novel role for nuclear PTEN in the stabilization of PPM1A.
18393632 SMAD 2/3 signaling directly supports NANOG expression, while SMAD 1/5/8 activation moderately represses SOX2.
18263591 interaction between RAP250, Smad2, and Smad3 constitutes an important bridging mechanism linking LXR and TGF-beta signaling pathways.
18223258 TGF-beta mediates its effects on proteoglycan synthesis in VSMCs via the ALK5/Smad2/3 phosphorylation pathway as well as via the p38 MAP kinase signaling cascade.
18210139 increased TGF-beta-Smad signaling in sporadic and familial ALS and impaired TGF-beta signal transduction in neurons of sporadic ALS patients, presumably at the step of pSmad2/3 translocation into the nucleus
18166170 Activin A increased and follistatin decreased phosphorylation of SMAD2/3 in vitro, and activin increased SMAD2 and decreased KITLG mRNA expression.
18082619 These findings suggest that CLU regulates TGF-beta signaling pathway by modulating the stability of Smad2/3 proteins.
17927854 The expression of Smad2/3 in cervical cancer had no correlation to clinical stage, pathologic classification, histological grade, and lymph node involvement, but was positively correlated to HPV16 E7 infection.
17875924 Mutant p53 attenuates TGF-beta1 signaling. This was exhibited by a reduction in SMAD2/3 phosphorylation and an inhibition of both the formation of SMAD2/SMAD4 complexes and the translocation of SMAD4 to the cell nucleus.
17729405 Aberrant location of expression/staining intensity of PTEN, PPM1A and P-Smad2 in hepatocellular carcinoma may impact disease progression.
17711623 The aberrant expressions of PTEN and phosphorylated Smad2 and their interaction may play an important role in the pathogenesis of hepatocellular carcinoma.
17591701 Results define Erbin as a novel negative modulator of Smad2/Smad3 functions and expand the physiological role of Erbin to the regulation of TGFbeta signaling.
17427197 High D-glucose increases L-arginine transport and eNOS expression following TbetaRII activation by TGF-beta1 involving p42/44(mapk) and Smad2 in HUVEC.
17365852 Platelets possess Smad2 protein and that its phosphorylation state is increased after exposure to TGF-beta1.
17295676 Breast cancer wiwthw hight expression of cancerous phosphorylated Smad2 tended to have a better prognosis, although statistic significance was never reached.
17292826 High Smad2 is associated with glioma
17217620 Disruption of the TGF-beta 1-Smad2 signaling pathway may lead to the resistance of TGF-beta 1 growth-inhibitory effect on oral squamous cell carcinoma.
17142261 Leptin and TGF-beta1 synergistically augmented activation of signalling components of mitogen-activated protein kinase (MAPK), STAT3 and Smad but did not modulate the expression of LEPR-B.
17053951 mRNA expressed in human granulosa-luteal cells at oocyte retrieval.
17035229 identified the small C-terminal domain phosphatase 1 (SCP1) as a specific phosphatase for Smad2/3 dephosphorylation in the linker and N terminus
16924420 These results suggest that p38 affects the phosphorylation of Smad2 and Smad3 differentially during TGF-beta signaling in human dental pulp cells and ERK1/2 might be involved in the process.
16645187 Our data indicate that TGF-beta1 induces endothelial barrier dysfunction involving Smad2-dependent p38 activation, resulting in RhoA activation by possible transcriptional regulation.
16556868 Activation of Smad3 but not Smad2 is a key mechanism by which Angioteinsin ii mediates artriosclerosis.
16478646 A novel missense mutation of SMAD2, located in exon 8 at codon 276 TCG (ser) -->TTG (leu), was identified in head and neck squamous cell carcinoma cell line SCC-15.
16437159 Babo/dSmad2 signaling prior to metamorphosis may be widely required to prepare neurons for the dynamic environment present during metamorphosis.
16403803 TGF-beta1 acts on adjacent stromal cells to turn on Smad2 signalling that could lead to stromal decidualization.
16260601 TGF-beta-dependent nuclear accumulation of Smad2 is caused exclusively by selective nuclear trapping of phosphorylated, complexed Smad2
16253118 Distinct roles for Smad2 and Smad3 in TGFbeta1-induced CTGF expression and markers of EMT in human PTECs are reported.
16179804 HIV-1 Tat-treated pulmonary arterial smooth muscle cells downregulate levels of phosphorylated SMAD2/3 proteins and SMAD2/3-SMAD4 protein complex, which are repressed by cocaine exposure
16146757 Smad4, but not Smad2, mediates TGF-beta1-induced MMP-2 expression in invasive extravillous trophoblasts
15811425 UV-induced down-regulation of TbetaRII and the concerted over-expression of Smad7 may trigger the inhibition of the TGF-beta-induced phosphorylation of Smad2.
15799969 TGF-beta signaling suppresses nuclear export of Smad4 by chromosome region maintenance 1 and targets Smad4 into the nucleus; mutations in Smad4 that affect its interaction with Smad2 or Smad3 impair nuclear accumulation of Smad4 in response to TGF-beta
15665291 c-Jun NH(2)-terminal kinase tended to induce the phosphorylation of Smad2/3L in human colorectal adenoma-carcinoma sequence.
15613484 internalization is important for transforming growth factor beta1-induced Smad2 association with Smad anchor for receptor activation (SARA) and Smad2-dependent signaling in human mesangial cells
15599395 caspase-3 is crucial for the differentiation of bone marrow stromal stem cells by influencing TGF-beta/Smad2 pathway and cell cycle progression
15520018 p38 MAP kinase and Rho/ROCK pathways together with Smad2 and Smad3 are necessary for TGF-beta-mediated growth inhibition
15496141 NEDD4-2 bound to TGF-beta-specific R-Smads, Smads 2 and 3, in a ligand-dependent manner, and induced degradation of Smad2, but not Smad3
15494412 TGF-beta-stimulation of transcription of PAI-1 is inhibited by VEGF, and TGF-beta phosphorylation of Smad2/3, an obligatory step of intracellular TGF-beta signaling, is suppressed by VEGF
15308665 Smad2/3 is activated in undifferentiated human embryonic stem cells and required for the expression of genes controlling Nodal signaling
15280432 Regulated cytoplasmic and nuclear retention may play a role in determining the distribution of Smads between the cytoplasm and the nucleus in both uninduced cells and upon TGF-beta induction.
15218362 Differential gene expression of Smad2, a tumor suppressor gene, plays a significant role in the proliferation of breast cancer
15166010 The most transcriptionally active splice variants of Smad2 are made in macrophages (but not SMCs) of fibrofatty lesions and are upregulated after cell differentiation from monocytes. Cyclin inhibitors are induced by Smads. Fibrous plaque SMCs make Smad2.
15066998 Tuberin (TSC2) interact with smad2/smad3 during TGF-beta1 growth regulation.
14727154 Observational study of gene-disease association. (HuGE Navigator)
14555988 Smad2, Smad3 and Smad4 contribute to the regulation of TGF-beta responses to varying extents, and exhibit distinct roles in different cell types
14531804 a signal transduction cascade of the TGF-beta/Smad signaling pathway, which is activated in the GEC, appears to be involved in the development of focal segmental glomerulosclerosis
12894231 A deletion of 'G' in the L3 loop (crucial in Smad-receptor interaction) & an insertion of 'A' in codon 122 (loss of MH2 domain) in cervical tumor cells caused frame shift & pretermination in Smad2, highlighting its important role in these tumors.
12760775 Results suggest that the Smad 2 may be the downstream signal transducers of TGF-beta(1) in human dental pulp cells.
12618756 In SMAD4-negative cell lines, TGF-beta caused Smad2 to move to the nucleus in a Smad4-independent fashion. Nuclear translocation of Smad2 was not sufficient to activate reporters for TGF-beta-induced transcriptional responses.
12615364 TGF-beta1 inhibited IFN-gamma and TNF-alpha-induced TARC production in HaCaT cells via Smad2/3. Modulation of TGF-beta/Smad signaling pathway may be beneficial for treatment of atopic dermatitis.
12531695 Phenotypic and functional changes associated with TGF-beta1-induced fibroblast terminal differentiation are differentially regulated by Smad2, Smad3, and Smad4.
12393416 Levels of phosphorylated Smad2/3 are sensors of the interplay between effects of retinoic acid and TGF-beta or vitamin D3 on monocytic and granulocytic differentiation of HL-60 cells.
12354674 overexpression of adenoviral Smad1 and Smad2 proteins without exogenously added ligands induced inhibin B production
12202987 Observational study of genotype prevalence. (HuGE Navigator)
12191474 Nucleocytoplasmic shuttling of Smads 2, 3, and 4 permits sensing of TGF-beta receptor activity.
12170265 activation of TGF-beta1/Smad2 signaling is associated with airway remodeling in asthma
12097320 HTLV-1 tax represses Smad-mediated TGF-beta signaling.
12034739 activation by transforming growth factor beta in absence of receptor endocytosis
12034730 c-Jun associates with the oncoprotein Ski and suppresses Smad2 transcriptional activity
12023901 repression of transactivating activity by association with a novel splice variant of CCAAT-binding factor C subunit
11779503 Crystal structure of a phosphorylated Smad2. Recognition of phosphoserine by the MH2 domain and insights on Smad function in TGF-beta signaling

AA Sequence

MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDELEKAITTQNC      1 - 70
NTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSH     71 - 140
HELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLVPRHTEILTELPPLDDYTHSIPENTNFPAGI    141 - 210
EPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYY    211 - 280
ELNQRVGETFHASQPSLTVDGFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECL    281 - 350
SDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVK    351 - 420
GWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS                           421 - 467
//

Text Mined References (384)

PMID Year Title
26974954 2016 Role of IGFBP7 in Diabetic Nephropathy: TGF-?1 Induces IGFBP7 via Smad2/4 in Human Renal Proximal Tubular Epithelial Cells.
26802603 2016 Smad2 increases the apoptosis of activated human hepatic stellate cells induced by TRAIL.
26708185 2015 High temperature requirement A1, transforming growth factor beta1, phosphoSmad2 and Ki67 in eutopic and ectopic endometrium of women with endometriosis.
26680585 2015 ShcA Protects against Epithelial-Mesenchymal Transition through Compartmentalized Inhibition of TGF-?-Induced Smad Activation.
26674378 2015 Enhanced Expression of miR-425 Promotes Esophageal Squamous Cell Carcinoma Tumorigenesis by Targeting SMAD2.
26647993 2016 Modulation of transforming growth factor?? signaling transducers in colon adenocarcinoma cells induced by staphylococcal enterotoxin B.
26608417 2016 Role of tumor-associated macrophages in the Hexim1 and TGF?/SMAD pathway, and their influence on progression of prostatic adenocarcinoma.
26445225 2015 Immunoexpression of TGF-?/Smad and VEGF-A proteins in serum and BAL fluid of sarcoidosis patients.
26384307 2015 Activin B induces human endometrial cancer cell adhesion, migration and invasion by up-regulating integrin ?3 via SMAD2/3 signaling.
26383977 2015 [Relationship between Expression of TGF-?1, Smad2, Smad4 and Prognosis ?of Patients with Resected Non-small Cell Lung Cancer].
26365350 2015 Follistatin-like 1 attenuates differentiation and survival of erythroid cells through Smad2/3 signaling.
26265084 Differing roles for TGF-?/Smad signaling in osteitis in chronic rhinosinusitis with and without nasal polyps.
26261683 2015 Cross-talk between TGF-?/Smad pathway and Wnt/?-catenin pathway in pathological scar formation.
26261569 2015 Astragaloside effect on TGF-?1, SMAD2/3, and ?-SMA expression in the kidney tissues of diabetic KKAy mice.
26247899 2015 SMAD2 Mutations Are Associated with Arterial Aneurysms and Dissections.
26150340 2015 Histone deacetylase 6 promotes growth of glioblastoma through inhibition of SMAD2 signaling.
26057631 2015 Mucin1 promotes the migration and invasion of hepatocellular carcinoma cells via JNK-mediated phosphorylation of Smad2 at the C-terminal and linker regions.
26045877 2015 Neovibsanin B increases extracellular matrix proteins in optic nerve head cells via activation of Smad signalling pathway.
25988335 2015 miR-212/132 downregulates SMAD2 expression to suppress the G1/S phase transition of the cell cycle and the epithelial to mesenchymal transition in cervical cancer cells.
25980495 2015 Inhibition of colorectal cancer stem cell survival and invasive potential by hsa-miR-140-5p mediated suppression of Smad2 and autophagy.
25971746 2015 NF-?B induces miR-148a to sustain TGF-?/Smad signaling activation in glioblastoma.
25921273 2015 ?-Catenin Regulates Primitive Streak Induction through Collaborative Interactions with SMAD2/SMAD3 and OCT4.
25893292 2016 Syntenin regulates TGF-?1-induced Smad activation and the epithelial-to-mesenchymal transition by inhibiting caveolin-mediated TGF-? type I receptor internalization.
25891879 2015 AST IV inhibits H?O?-induced human umbilical vein endothelial cell apoptosis by suppressing Nox4 expression through the TGF-?1/Smad2 pathway.
25882870 2015 Involvement of smad2 and Erk/Akt cascade in TGF-?1-induced apoptosis in human gingival epithelial cells.
25843708 2015 The lncRNA DEANR1 facilitates human endoderm differentiation by activating FOXA2 expression.
25701598 2015 TGF-?/Smad2/3 signal pathway involves in U251 cell proliferation and apoptosis.
25670079 2015 14-3-3? turns TGF-?'s function from tumor suppressor to metastasis promoter in breast cancer by contextual changes of Smad partners from p53 to Gli2.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25586740 2015 MicroRNA-10a silencing reverses cisplatin resistance in the A549/cisplatin human lung cancer cell line via the transforming growth factor-?/Smad2/STAT3/STAT5 pathway.
25557170 2015 Overexpression of Nodal induces a metastatic phenotype in pancreatic cancer cells via the Smad2/3 pathway.
25542272 2015 Increased pSmad2 expression and cytoplasmic predominant presence of TGF-?RII in breast cancer tissue are associated with poor prognosis: results from the Shanghai Breast Cancer Study.
25477335 2014 H3K9 histone methyltransferase, KMT1E/SETDB1, cooperates with the SMAD2/3 pathway to suppress lung cancer metastasis.
25476248 2014 Increased constitutive ?SMA and Smad2/3 expression in idiopathic pulmonary fibrosis myofibroblasts is KCa3.1-dependent.
25373709 2014 High p-Smad2 expression in stromal fibroblasts predicts poor survival in patients with clinical stage I to IIIA non-small cell lung cancer.
25351340 2015 Smad2 protects against TGF-?1/Smad3-mediated collagen synthesis in human hepatic stellate cells during hepatic fibrosis.
25342595 2015 Ammonium chloride inhibits autophagy of hepatocellular carcinoma cells through SMAD2 signaling.
25304053 2014 Lefty inhibits glioma growth by suppressing Nodal-activated Smad and ERK1/2 pathways.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25232019 2014 Altered decorin and Smad expression in human fetal membranes in PPROM.
25207745 2015 Roles of TGF-?/Smad signaling pathway in pathogenesis and development of gluteal muscle contracture.
25198664 2013 Targeting Smad2 and Smad3 by miR-136 suppresses metastasis-associated traits of lung adenocarcinoma cells.
25166914 2014 Tumor suppressor microRNA-27a in colorectal carcinogenesis and progression by targeting SGPP1 and Smad2.
25105734 2014 Activin A, B, and AB increase human trophoblast cell invasion by up-regulating N-cadherin.
25105025 2014 TGF- ? Signaling Cooperates with AT Motif-Binding Factor-1 for Repression of the ? -Fetoprotein Promoter.
24925688 2014 Opposing roles for Smad2 and Smad3 in peritoneal fibrosis in vivo and in vitro.
24911914 2015 Implication of Smad2 and Smad3 in transforming growth factor-?-induced posterior capsular opacification of human lens epithelial cells.
24892945 2014 MicroRNA-146a regulates human foetal femur derived skeletal stem cell differentiation by down-regulating SMAD2 and SMAD3.
24788939 2014 The complex interplay between ERK1/2, TGF?/Smad, and Jagged/Notch signaling pathways in the regulation of epithelial-mesenchymal transition in retinal pigment epithelium cells.
24771066 2014 ZNF580 mediates eNOS expression and endothelial cell migration/proliferation via the TGF-?1/ALK5/Smad2 pathway.
24717670 2014 Genetic testing in cardiovascular diseases.
24696849 2014 Nodal promotes the self-renewal of human colon cancer stem cells via an autocrine manner through Smad2/3 signaling pathway.
24664294 2014 Variations of microRNAs in human placentas and plasma from preeclamptic pregnancy.
24627487 2014 C18 ORF1, a novel negative regulator of transforming growth factor-? signaling.
24613014 2014 Prostaglandin E2 modifies SMAD2 and promotes SMAD2-SMAD4 complex formation.
24530353 2014 Epithelial-mesenchymal transition involved in pulmonary fibrosis induced by multi-walled carbon nanotubes via TGF-beta/Smad signaling pathway.
24503541 2014 Galectin-1 stimulates motility of human umbilical cord blood-derived mesenchymal stem cells by downregulation of smad2/3-dependent collagen 3/5 and upregulation of NF-?B-dependent fibronectin/laminin 5 expression.
24477908 2014 Smad and NFAT pathways cooperate to induce CD103 expression in human CD8 T lymphocytes.
24427302 2014 High expression of IGFBP7 in fibroblasts induced by colorectal cancer cells is co-regulated by TGF-? and Wnt signaling in a Smad2/3-Dvl2/3-dependent manner.
24394555 2014 microRNA-181a has a critical role in ovarian cancer progression through the regulation of the epithelial-mesenchymal transition.
24370825 2014 TGF-? promotes glioma cell growth via activating Nodal expression through Smad and ERK1/2 pathways.
24347165 2014 Glucocorticoids recruit Tgfbr3 and Smad1 to shift transforming growth factor-? signaling from the Tgfbr1/Smad2/3 axis to the Acvrl1/Smad1 axis in lung fibroblasts.
24324267 2014 Zinc finger protein 451 is a novel Smad corepressor in transforming growth factor-? signaling.
24269534 2014 TGF-?-Smad2 dependent activation of CDC 25A plays an important role in cell proliferation through NFAT activation in metastatic breast cancer cells.
24183998 2014 Osteosarcoma cells promote the production of pro-tumor cytokines in mesenchymal stem cells by inhibiting their osteogenic differentiation through the TGF-?/Smad2/3 pathway.
24098582 2013 TRPV1 potentiates TGF?-induction of corneal myofibroblast development through an oxidative stress-mediated p38-SMAD2 signaling loop.
24052079 2013 PIAS1-modulated Smad2/4 complex activation is involved in zinc-induced cancer cell apoptosis.
23929584 2014 Genetic susceptibility to chronic otitis media with effusion: candidate gene single nucleotide polymorphisms.
23916701 2013 miR-18b inhibits TGF-?1-induced differentiation of hair follicle stem cells into smooth muscle cells by targeting SMAD2.
23873106 2013 microRNA-148a suppresses human gastric cancer cell metastasis by reversing epithelial-to-mesenchymal transition.
23814118 2013 Smad2-dependent protease nexin-1 overexpression differentiates chronic aneurysms from acute dissections of human ascending aorta.
23804438 2013 Computational modelling of Smad-mediated negative feedback and crosstalk in the TGF-? superfamily network.
23779087 2013 Inhibition of TGF-? signaling at the nuclear envelope: characterization of interactions between MAN1, Smad2 and Smad3, and PPM1A.
23747729 2013 Activin stimulates CYP19A gene expression in human ovarian granulosa cell-like KGN cells via the Smad2 signaling pathway.
23738652 2014 Overexpression of Smad2 inhibits proliferation of gingival epithelial cells.
23666711 2013 Polycomb determines responses to smad2/3 signaling in embryonic stem cell differentiation and in reprogramming.
23649632 2013 Smad2 is essential for maintenance of the human and mouse primed pluripotent stem cell state.
23591895 2013 Araf kinase antagonizes Nodal-Smad2 activity in mesendoderm development by directly phosphorylating the Smad2 linker region.
23478445 2013 CRL1-FBXO11 promotes Cdt2 ubiquitylation and degradation and regulates Pr-Set7/Set8-mediated cellular migration.
23419524 2013 TGF-?1-induced epithelial-mesenchymal transition and acetylation of Smad2 and Smad3 are negatively regulated by EGCG in human A549 lung cancer cells.
23297089 2013 Syndecan-2 is a key regulator of transforming growth factor beta 2/Smad2-mediated adhesion in fibrosarcoma cells.
23295196 2013 Important role of the angiotensin II pathway in producing matrix metalloproteinase-9 in human thoracic aortic aneurysms.
23259454 2013 NKX2-1 activation by SMAD2 signaling after definitive endoderm differentiation in human embryonic stem cell.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23139211 2013 SMAD2, SMAD3 and SMAD4 mutations in colorectal cancer.
23077590 2012 Non-canonical Smads phosphorylation induced by the glutamate release inhibitor, riluzole, through GSK3 activation in melanoma.
22999704 Smad2-dependent glycosaminoglycan elongation in aortic valve interstitial cells enhances binding of LDL to proteoglycans.
22935165 Skewed TGF?/Smad signalling pathway in T cells in patients with Behçet's disease.
22868198 2012 The activities of Smad and Gli mediated signalling pathways in high-grade conventional osteosarcoma.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22781750 2012 Protein phosphatase 5 modulates SMAD3 function in the transforming growth factor-? pathway.
22710166 2012 Dynamics of TGF-?/Smad signaling.
22705205 2012 TGF-? inhibits the uptake of modified low density lipoprotein by human macrophages through a Smad-dependent pathway: a dominant role for Smad-2.
22617150 2012 Post-translational regulation of TGF-? receptor and Smad signaling.
22563507 2012 R-Smad competition controls activin receptor output in Drosophila.
22461896 2012 Dynamic regulation of Tgf-B signaling by Tif1?: a computational approach.
22442258 2012 Intercellular variation in signaling through the TGF-? pathway and its relation to cell density and cell cycle phase.
22426647 2012 microRNA-155 is downregulated in gastric cancer cells and involved in cell metastasis.
22385658 2012 Signaling network crosstalk in human pluripotent cells: a Smad2/3-regulated switch that controls the balance between self-renewal and differentiation.
22301403 2012 Examination of Smad2 and Smad4 copy-number variations in skin cancers.
22278155 2012 Prognostic significance of transforming growth factor beta (TGF-?) signaling axis molecules and E-cadherin in colorectal cancer.
22228025 2012 Increased TGF-?1-mediated suppression of growth and motility in castrate-resistant prostate cancer cells is consistent with Smad2/3 signaling.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22045334 2011 Ablation of Smurf2 reveals an inhibition in TGF-? signalling through multiple mono-ubiquitination of Smad3.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21960005 2011 PPM1A dephosphorylates RanBP3 to enable efficient nuclear export of Smad2 and Smad3.
21947082 2011 USP15 is a deubiquitylating enzyme for receptor-activated SMADs.
21883378 2012 Cell biology of Smad2/3 linker region phosphorylation in vascular smooth muscle.
21828274 2011 HEB and E2A function as SMAD/FOXH1 cofactors.
21749466 2012 Non-invasive detection of spatio-temporal activation of SBE and NFAT5 promoters in transgenic reporter mice following stroke.
21741598 2011 A Pin1/mutant p53 axis promotes aggressiveness in breast cancer.
21732483 2011 Enrichment of human ESC-derived multipotent mesenchymal stem cells with immunosuppressive and anti-inflammatory properties capable to protect against experimental inflammatory bowel disease.
21646355 2011 Cell type-specific target selection by combinatorial binding of Smad2/3 proteins and hepatocyte nuclear factor 4alpha in HepG2 cells.
21624123 2011 Differential roles of Smad2 and Smad3 in the regulation of TGF-?1-mediated growth inhibition and cell migration in pancreatic ductal adenocarcinoma cells: control by Rac1.
21599657 2011 ZNF580, a novel C2H2 zinc-finger transcription factor, interacts with the TGF-? signal molecule Smad2.
21532621 2011 Nodal enhances the activity of FoxO3a and its synergistic interaction with Smads to regulate cyclin G2 transcription in ovarian cancer cells.
21490324 2011 Flow-dependent Smad2 phosphorylation and TGIF nuclear localization in human aortic endothelial cells.
21406405 2011 MAP kinase-interacting kinase 1 regulates SMAD2-dependent TGF-? signaling pathway in human glioblastoma.
21377836 2011 Activation of the activin A-ALK-Smad pathway in systemic sclerosis.
21297662 2011 Homeodomain protein DLX4 counteracts key transcriptional control mechanisms of the TGF-? cytostatic program and blocks the antiproliferative effect of TGF-?.
21269460 2011 Initial characterization of the human central proteome.
21258410 2011 Selective targeting of activating and inhibitory Smads by distinct WWP2 ubiquitin ligase isoforms differentially modulates TGF? signalling and EMT.
21170261 2010 Induction of ?Np63 by the newly identified keratinocyte-specific transforming growth factor ? Signaling Pathway with Smad2 and I?B Kinase ? in squamous cell carcinoma.
21110833 2010 Phosphorylated smad2 in advanced stage gastric carcinoma.
21106222 2011 Latent TGF-? binding proteins (LTBPs) 1 and 3 differentially regulate transforming growth factor-? activity in malignant mesothelioma.
21095583 2010 PARP-1 attenuates Smad-mediated transcription.
21081648 2010 IKK(?) controls canonical TGF(ß)-SMAD signaling to regulate genes expressing SNAIL and SLUG during EMT in panc1 cells.
21068203 2011 Genetic variation in the TGF-? signaling pathway and colon and rectal cancer risk.
21052639 2011 Association of SMAD2 polymorphisms with bone mineral density in postmenopausal Korean women.
21036908 2010 MicroRNA-155 targets SMAD2 and modulates the response of macrophages to transforming growth factor-{beta}.
20977504 2011 Transforming growth factor-?/Smad - signalling pathway and conjunctival remodelling in vernal keratoconjunctivitis.
20954112 2011 TGF?/activin signaling pathway activation in intimal hyperplasia and atherosclerosis.
20945383 2011 Role of Smad2/3 and p38 MAP kinase in TGF-?1-induced epithelial-mesenchymal transition of pulmonary epithelial cells.
20852387 2010 HGF upregulation contributes to angiogenesis in mice with keratinocyte-specific Smad2 deletion.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20717921 2010 Thapsigargin-induced Ca2+ increase inhibits TGF?1-mediated Smad2 transcriptional responses via Ca2+/calmodulin-dependent protein kinase II.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20607798 2010 TGF?1 induces IL-6 and inhibits IL-8 release in human bronchial epithelial cells: the role of Smad2/3.
20604712 2010 ?-Lipoic acid induces collagen biosynthesis involving prolyl hydroxylase expression via activation of TGF-?-Smad signaling in human dermal fibroblasts.
20603019 2010 TIF1gamma controls erythroid cell fate by regulating transcription elongation.
20462450 2010 Smad2 and Smad6 as predictors of overall survival in oral squamous cell carcinoma patients.
20460105 2010 Induced expression of bone morphogenetic protein-6 and Smads signaling in human monocytes derived dendritic cells during sickle-cell pathology with orthopedic complications.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20350217 2010 Expression of Smad and its signalling cascade in osteosarcoma.
20347004 2010 Lactoferrin induces growth arrest and nuclear accumulation of Smad-2 in HeLa cells.
20346360 2010 Genetic risk factors for hepatopulmonary syndrome in patients with advanced liver disease.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
20129061 2010 TMEPAI, a transmembrane TGF-beta-inducible protein, sequesters Smad proteins from active participation in TGF-beta signaling.
20086175 2010 Smad signaling is required to maintain epigenetic silencing during breast cancer progression.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20061380 2010 MTMR4 attenuates transforming growth factor beta (TGFbeta) signaling by dephosphorylating R-Smads in endosomes.
20011542 2009 Activin signaling in microsatellite stable colon cancers is disrupted by a combination of genetic and epigenetic mechanisms.
20010874 2010 Smad2 and Smad3 have opposing roles in breast cancer bone metastasis by differentially affecting tumor angiogenesis.
19951945 2010 Hypoxia-activated Smad3-specific dephosphorylation by PP2A.
19937272 2010 Expression of TGF-beta signaling factors in invasive breast cancers: relationships with age at diagnosis and tumor characteristics.
19917253 2009 Ubiquitin ligase Nedd4L targets activated Smad2/3 to limit TGF-beta signaling.
19827952 2010 TGF-beta enhances the integrin alpha2beta1-mediated attachment of mesenchymal stem cells to type I collagen.
19822523 2009 p130Cas is required for mammary tumor growth and transforming growth factor-beta-mediated metastasis through regulation of Smad2/3 activity.
19819941 2009 Smad1-Smad5 ovarian conditional knockout mice develop a disease profile similar to the juvenile form of human granulosa cell tumors.
19751112 2009 BMP-11 and myostatin support undifferentiated growth of human embryonic stem cells in feeder-free cultures.
19688145 2009 Downregulation of SMAD2, 4 and 6 mRNA and TGFbeta receptor I mRNA in lesional and non-lesional psoriatic skin.
19620243 2009 Role of SARA (SMAD anchor for receptor activation) in maintenance of epithelial cell phenotype.
19558215 2009 Transforming growth factor-beta1 up-regulation of human alpha(1)(I) collagen is mediated by Sp1 and Smad2 transacting factors.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19429239 2009 15-deoxy-Delta(12,14)-prostaglandin J(2) inhibits fibrogenic response in human hepatoma cells.
19421146 2009 Blockade of Cripto binding to cell surface GRP78 inhibits oncogenic Cripto signaling via MAPK/PI3K and Smad2/3 pathways.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19397700 2009 Angiotensin II activates connective tissue growth factor and induces extracellular matrix changes involving Smad/activation and p38 mitogen-activated protein kinase signalling pathways in human dermal fibroblasts.
19366699 2009 Bone morphogenetic protein (BMP) and activin type II receptors balance BMP9 signals mediated by activin receptor-like kinase-1 in human pulmonary artery endothelial cells.
19351817 2009 Genetic mutations associated with cigarette smoking in pancreatic cancer.
19345189 2009 A Mutant-p53/Smad complex opposes p63 to empower TGFbeta-induced metastasis.
19289081 2009 Nuclear export of Smad2 and Smad3 by RanBP3 facilitates termination of TGF-beta signaling.
19211612 2009 A new nonsense mutation of SMAD8 associated with pulmonary arterial hypertension.
19201832 2009 CDK2 phosphorylation of Smad2 disrupts TGF-beta transcriptional regulation in resistant primary bone marrow myeloma cells.
19135894 2009 FAM/USP9x, a deubiquitinating enzyme essential for TGFbeta signaling, controls Smad4 monoubiquitination.
19122240 2009 Pin1 down-regulates transforming growth factor-beta (TGF-beta) signaling by inducing degradation of Smad proteins.
19104148 2009 Epithelial cell alpha3beta1 integrin links beta-catenin and Smad signaling to promote myofibroblast formation and pulmonary fibrosis.
19066393 2009 Acquired variation outweighs inherited variation in whole genome analysis of methotrexate polyglutamate accumulation in leukemia.
19049980 2009 SKI and MEL1 cooperate to inhibit transforming growth factor-beta signal in gastric cancer cells.
19018011 2008 Holding their own: the noncanonical roles of Smad proteins.
18983975 2008 Cyclic stretch-induced TGFbeta1/Smad signaling inhibits adipogenesis in umbilical cord progenitor cells.
18955504 2009 Chromatin immunoprecipitation on microarray analysis of Smad2/3 binding sites reveals roles of ETS1 and TFAP2A in transforming growth factor beta signaling.
18949743 SMAD2 and the relationship of colorectal cancer to inflammatory bowel disease.
18923419 2008 An Id-like molecule, HHM, is a synexpression group-restricted regulator of TGF-beta signalling.
18832382 2008 HMGA2 and Smads co-regulate SNAIL1 expression during induction of epithelial-to-mesenchymal transition.
18826955 2008 An activin/furin regulatory loop modulates the processing and secretion of inhibin alpha- and betaB-subunit dimers in pituitary gonadotrope cells.
18729074 2008 Identification of novel Smad2 and Smad3 associated proteins in response to TGF-beta1.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18648910 2008 Effect of TGF-beta/Smad signaling on sertoli cell and possible mechanism related to complete sertoli cell-only syndrome.
18618014 2008 Keratinocyte-specific Smad2 ablation results in increased epithelial-mesenchymal transition during skin cancer formation and progression.
18616749 2008 Expression of Smad protein by normal skin fibroblasts and hypertrophic scar fibroblasts in response to transforming growth factor beta1.
18568018 2008 TAZ controls Smad nucleocytoplasmic shuttling and regulates human embryonic stem-cell self-renewal.
18511908 2008 Identification of PCTA, a TGIF antagonist that promotes PML function in TGF-beta signalling.
18482992 2008 Opposite effects of dihydrosphingosine 1-phosphate and sphingosine 1-phosphate on transforming growth factor-beta/Smad signaling are mediated through the PTEN/PPM1A-dependent pathway.
18393632 2008 Control of early fate decisions in human ES cells by distinct states of TGFbeta pathway activity.
18263591 2008 RAP250 is a coactivator in the transforming growth factor beta signaling pathway that interacts with Smad2 and Smad3.
18223258 2008 Smad and p38 MAP kinase-mediated signaling of proteoglycan synthesis in vascular smooth muscle.
18210139 2008 Phosphorylated Smad2/3 immunoreactivity in sporadic and familial amyotrophic lateral sclerosis and its mouse model.
18166170 2008 Activin signals via SMAD2/3 between germ and somatic cells in the human fetal ovary and regulates kit ligand expression.
18082619 2008 Clusterin, a novel modulator of TGF-beta signaling, is involved in Smad2/3 stability.
17927854 2007 [Expression and significance of Smad2/3 and HPV16 E7 in cervical intraepithelial neoplasia and cervical carcinoma].
17878231 2007 Cholesterol suppresses cellular TGF-beta responsiveness: implications in atherogenesis.
17875924 2007 Mutant p53 attenuates the SMAD-dependent transforming growth factor beta1 (TGF-beta1) signaling pathway by repressing the expression of TGF-beta receptor type II.
17729405 2007 Expression of PTEN, PPM1A and P-Smad2 in hepatocellular carcinomas and adjacent liver tissues.
17711623 2007 [Expressions of phosphorylated-Smad2 and PTEN in hepatocellular carcinomas and adjacent liver tissues].
17591701 2007 Erbin inhibits transforming growth factor beta signaling through a novel Smad-interacting domain.
17438144 2007 Smad7 antagonizes transforming growth factor beta signaling in the nucleus by interfering with functional Smad-DNA complex formation.
17427197 2007 D-glucose stimulation of L-arginine transport and nitric oxide synthesis results from activation of mitogen-activated protein kinases p42/44 and Smad2 requiring functional type II TGF-beta receptors in human umbilical vein endothelium.
17365852 2007 Platelets possess functional TGF-beta receptors and Smad2 protein.
17327236 2007 3-Phosphoinositide-dependent PDK1 negatively regulates transforming growth factor-beta-induced signaling in a kinase-dependent manner through physical interaction with Smad proteins.
17295676 2007 Effect of the different phosphorylated Smad2 protein localizations on the invasive breast carcinoma phenotype.
17292826 2007 High TGFbeta-Smad activity confers poor prognosis in glioma patients and promotes cell proliferation depending on the methylation of the PDGF-B gene.
17292623 2007 Fussel-15, a novel Ski/Sno homolog protein, antagonizes BMP signaling.
17239842 2007 The left-right axis is regulated by the interplay of Coco, Xnr1 and derrière in Xenopus embryos.
17217620 2006 Loss of p12CDK2-AP1 expression in human oral squamous cell carcinoma with disrupted transforming growth factor-beta-Smad signaling pathway.
17142261 2007 Leptin augments myofibroblastic conversion and fibrogenic activity of human peritoneal mesothelial cells: a functional implication for peritoneal fibrosis.
17099224 2006 Potentiation of Smad-mediated transcriptional activation by the RNA-binding protein RBPMS.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17074756 2006 The DNA binding activities of Smad2 and Smad3 are regulated by coactivator-mediated acetylation.
17053951 Expression of inhibin-activin subunits, follistatin and smads in granulosa-luteal cells collected at oocyte retrieval.
17035229 2006 Small C-terminal domain phosphatases dephosphorylate the regulatory linker regions of Smad2 and Smad3 to enhance transforming growth factor-beta signaling.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16924420 2006 p38 Mitogen-activated protein kinase affects transforming growth factor-beta/Smad signaling in human dental pulp cells.
16862174 2007 Smad3 is acetylated by p300/CBP to regulate its transactivation activity.
16806156 2006 Epithelial and ectomesenchymal role of the type I TGF-beta receptor ALK5 during facial morphogenesis and palatal fusion.
16751102 2006 Hematopoiesis controlled by distinct TIF1gamma and Smad4 branches of the TGFbeta pathway.
16751101 2006 PPM1A functions as a Smad phosphatase to terminate TGFbeta signaling.
16645187 2006 Transforming growth factor-beta1-induced endothelial barrier dysfunction involves Smad2-dependent p38 activation and subsequent RhoA activation.
16556868 2006 Essential role of Smad3 in angiotensin II-induced vascular fibrosis.
16478646 2007 Disruption of transforming growth factor beta-Smad signaling pathway in head and neck squamous cell carcinoma as evidenced by mutations of SMAD2 and SMAD4.
16437159 2006 Baboon/dSmad2 TGF-beta signaling is required during late larval stage for development of adult-specific neurons.
16403803 2005 Progesterone-dependent release of transforming growth factor-beta1 from epithelial cells enhances the endometrial decidualization by turning on the Smad signalling in stromal cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16260601 2005 Kinetic analysis of Smad nucleocytoplasmic shuttling reveals a mechanism for transforming growth factor beta-dependent nuclear accumulation of Smads.
16253118 2006 The differential role of Smad2 and Smad3 in the regulation of pro-fibrotic TGFbeta1 responses in human proximal-tubule epithelial cells.
16200078 2005 Cloning and functional characterization of a new Ski homolog, Fussel-18, specifically expressed in neuronal tissues.
16146757 2006 Involvement of SMAD4, but not of SMAD2, in transforming growth factor-beta1-induced trophoblast expression of matrix metalloproteinase-2.
16055724 2005 Positive and negative regulation of the transforming growth factor beta/activin target gene goosecoid by the TFII-I family of transcription factors.
16007227 2005 Notch4 intracellular domain binding to Smad3 and inhibition of the TGF-beta signaling.
15811425 2005 Alteration of the TGF-beta/SMAD pathway in intrinsically and UV-induced skin aging.
15799969 2005 Nuclear targeting of transforming growth factor-beta-activated Smad complexes.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15750622 2005 Selective inhibition of TGF-beta responsive genes by Smad-interacting peptide aptamers from FoxH1, Lef1 and CBP.
15735739 2005 TGFbeta1/Smad3 counteracts BRCA1-dependent repair of DNA damage.
15665291 2005 Acceleration of Smad2 and Smad3 phosphorylation via c-Jun NH(2)-terminal kinase during human colorectal carcinogenesis.
15647271 2005 The integral inner nuclear membrane protein MAN1 physically interacts with the R-Smad proteins to repress signaling by the transforming growth factor-{beta} superfamily of cytokines.
15613484 2005 The role of internalization in transforming growth factor beta1-induced Smad2 association with Smad anchor for receptor activation (SARA) and Smad2-dependent signaling in human mesangial cells.
15601644 2005 MAN1, an integral protein of the inner nuclear membrane, binds Smad2 and Smad3 and antagonizes transforming growth factor-beta signaling.
15599395 2004 A crucial role of caspase-3 in osteogenic differentiation of bone marrow stromal stem cells.
15520018 2005 Role of Rho/ROCK and p38 MAP kinase pathways in transforming growth factor-beta-mediated Smad-dependent growth inhibition of human breast carcinoma cells in vivo.
15496141 2005 NEDD4-2 (neural precursor cell expressed, developmentally down-regulated 4-2) negatively regulates TGF-beta (transforming growth factor-beta) signalling by inducing ubiquitin-mediated degradation of Smad2 and TGF-beta type I receptor.
15494412 2004 Vascular endothelial cell growth factor attenuates actions of transforming growth factor-beta in human endothelial cells.
15489854 2004 Loss-of-function mutations in LEMD3 result in osteopoikilosis, Buschke-Ollendorff syndrome and melorheostosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15356634 2004 Cytoplasmic PML function in TGF-beta signalling.
15350224 2004 Structural basis of heteromeric smad protein assembly in TGF-beta signaling.
15326485 2004 TGF-beta and HGF transmit the signals through JNK-dependent Smad2/3 phosphorylation at the linker regions.
15308665 2004 Expression of nodal, lefty-a, and lefty-B in undifferentiated human embryonic stem cells requires activation of Smad2/3.
15280432 2004 Analysis of Smad nucleocytoplasmic shuttling in living cells.
15241418 2004 Cyclin-dependent kinases regulate the antiproliferative function of Smads.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15218362 2004 Differential gene expression of TGF beta inducible early gene (TIEG), Smad7, Smad2 and Bard1 in normal and malignant breast tissue.
15166010 2004 Smad expression in human atherosclerotic lesions: evidence for impaired TGF-beta/Smad signaling in smooth muscle cells of fibrofatty lesions.
15150278 2004 Nodal and ALK7 inhibit proliferation and induce apoptosis in human trophoblast cells.
15144564 2004 Direct interaction between Smad3, APC10, CDH1 and HEF1 in proteasomal degradation of HEF1.
15107821 2004 c-Ski inhibits the TGF-beta signaling pathway through stabilization of inactive Smad complexes on Smad-binding elements.
15084259 2004 Integration of Smad and forkhead pathways in the control of neuroepithelial and glioblastoma cell proliferation.
15066998 2004 Tuberous sclerosis complex 2 gene product interacts with human SMAD proteins. A molecular link of two tumor suppressor pathways.
14728725 2004 Cloning of a novel signaling molecule, AMSH-2, that potentiates transforming growth factor beta signaling.
14727154 2004 LRP5, low-density-lipoprotein-receptor-related protein 5, is a determinant for bone mineral density.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14691252 2004 Activation of Smad transcriptional activity by protein inhibitor of activated STAT3 (PIAS3).
14612439 2004 A novel E1A-like inhibitor of differentiation (EID) family member, EID-2, suppresses transforming growth factor (TGF)-beta signaling by blocking TGF-beta-induced formation of Smad3-Smad4 complexes.
14555988 2003 Differential regulation of TGF-beta signaling through Smad2, Smad3 and Smad4.
14531804 2003 Activation of the TGF-beta/Smad signaling pathway in focal segmental glomerulosclerosis.
12894231 2003 Loss of expression, and mutations of Smad 2 and Smad 4 in human cervical cancer.
12874272 2003 Requirement of the co-repressor homeodomain-interacting protein kinase 2 for ski-mediated inhibition of bone morphogenetic protein-induced transcriptional activation.
12764135 2003 The transforming activity of Ski and SnoN is dependent on their ability to repress the activity of Smad proteins.
12760775 2003 [The roles of Smad 2/3 in transforming growth factor-beta 1 signaling in human dental pulp cells].
12743038 2003 Opposing functions of ZEB proteins in the regulation of the TGFbeta/BMP signaling pathway.
12732139 2003 Links between tumor suppressors: p53 is required for TGF-beta gene responses by cooperating with Smads.
12650946 2003 Identification of three novel Smad binding proteins involved in cell polarity.
12618756 2003 TGF-beta-induced nuclear localization of Smad2 and Smad3 in Smad4 null cancer cell lines.
12615364 2003 TGF-beta/Smad signaling inhibits IFN-gamma and TNF-alpha-induced TARC (CCL17) production in HaCaT cells.
12531695 2003 TGF-beta1-mediated fibroblast-myofibroblast terminal differentiation-the role of Smad proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12411310 2003 Cellular response to hypoxia involves signaling via Smad proteins.
12393416 2003 Levels of phospho-Smad2/3 are sensors of the interplay between effects of TGF-beta and retinoic acid on monocytic and granulocytic differentiation of HL-60 cells.
12370310 2002 Identification of mZnf8, a mouse Krüppel-like transcriptional repressor, as a novel nuclear interaction partner of Smad1.
12354674 2002 Engagement of activin and bone morphogenetic protein signaling pathway Smad proteins in the induction of inhibin B production in ovarian granulosa cells.
12202987 2002 A catalog of 106 single-nucleotide polymorphisms (SNPs) and 11 other types of variations in genes for transforming growth factor-beta1 (TGF-beta1) and its signaling pathway.
12193595 2002 Modulation of Smad2-mediated signaling by extracellular signal-regulated kinase.
12191474 2002 Nucleocytoplasmic shuttling of Smads 2, 3, and 4 permits sensing of TGF-beta receptor activity.
12191473 2002 Smad2 nucleocytoplasmic shuttling by nucleoporins CAN/Nup214 and Nup153 feeds TGFbeta signaling complexes in the cytoplasm and nucleus.
12170265 2002 Activation of TGF-beta/Smad2 signaling is associated with airway remodeling in asthma.
12167862 2002 A component of the ARC/Mediator complex required for TGF beta/Nodal signalling.
12150994 2002 E2F4/5 and p107 as Smad cofactors linking the TGFbeta receptor to c-myc repression.
12105419 2002 Metastasis is driven by sequential elevation of H-ras and Smad2 levels.
12097320 2002 Human T-cell lymphotropic virus type 1 tax inhibits transforming growth factor-beta signaling by blocking the association of Smad proteins with Smad-binding element.
12034739 2002 Transforming growth factor beta activates Smad2 in the absence of receptor endocytosis.
12034730 2002 c-Jun associates with the oncoprotein Ski and suppresses Smad2 transcriptional activity.
12023901 2002 Repression of Smad2 and Smad3 transactivating activity by association with a novel splice variant of CCAAT-binding factor C subunit.
12000714 2002 Interaction between the transforming growth factor-beta type II receptor/Smad pathway and beta-catenin during transforming growth factor-beta1-mediated adherens junction disassembly.
11879191 2002 Decorin suppresses transforming growth factor-beta-induced expression of plasminogen activator inhibitor-1 in human mesangial cells through a mechanism that involves Ca2+-dependent phosphorylation of Smad2 at serine-240.
11804592 2002 Direct interaction of c-Myc with Smad2 and Smad3 to inhibit TGF-beta-mediated induction of the CDK inhibitor p15(Ink4B).
11691834 2001 Smad3 recruits the anaphase-promoting complex for ubiquitination and degradation of SnoN.
11555647 2001 Cross-talk between transforming growth factor-beta and estrogen receptor signaling through Smad3.
11438668 2001 Axin facilitates Smad3 activation in the transforming growth factor beta signaling pathway.
11389444 2001 TGF-beta induces assembly of a Smad2-Smurf2 ubiquitin ligase complex that targets SnoN for degradation.
11387330 2001 Functional cloning of the proto-oncogene brain factor-1 (BF-1) as a Smad-binding antagonist of transforming growth factor-beta signaling.
11387212 2001 The adaptor molecule Disabled-2 links the transforming growth factor beta receptors to the Smad pathway.
11371641 2001 c-Jun interacts with the corepressor TG-interacting factor (TGIF) to suppress Smad2 transcriptional activity.
11359933 2001 Ligand-dependent degradation of Smad3 by a ubiquitin ligase complex of ROC1 and associated proteins.
11278756 2001 Ski-interacting protein interacts with Smad proteins to augment transforming growth factor-beta-dependent transcription.
11278302 2001 Transforming growth factor-beta receptor-associated protein 1 is a Smad4 chaperone.
11274206 2001 Formation of a stable heterodimer between Smad2 and Smad4.
11264182 2001 Human T-cell leukemia virus type I oncoprotein Tax represses Smad-dependent transforming growth factor beta signaling through interaction with CREB-binding protein/p300.
11229886 2001 Transcriptional regulation of the human apolipoprotein genes.
11163184 2000 Negative regulation of BMP/Smad signaling by Tob in osteoblasts.
11160896 2001 Smad proteins function as co-modulators for MEF2 transcriptional regulatory proteins.
11118211 2000 A novel ability of Smad3 to regulate proteasomal degradation of a Cas family member HEF1.
11114293 2001 Sp1 and Smad proteins cooperate to mediate transforming growth factor-beta 1-induced alpha 2(I) collagen expression in human glomerular mesangial cells.
11100470 2001 Phosphorylation of Smad signaling proteins by receptor serine/threonine kinases.
11094085 2000 Hgs (Hrs), a FYVE domain protein, is involved in Smad signaling through cooperation with SARA.
11058129 2000 The transcriptional co-activator P/CAF potentiates TGF-beta/Smad signaling.
11043574 2000 Identification and characterization of constitutively active Smad2 mutants: evaluation of formation of Smad complex and subcellular distribution.
11042172 2001 Hoxa-9 represses transforming growth factor-beta-induced osteopontin gene transcription.
11027280 2000 Inactivation of smad-transforming growth factor beta signaling by Ca(2+)-calmodulin-dependent protein kinase II.
11016919 2000 Smurf2 is a ubiquitin E3 ligase mediating proteasome-dependent degradation of Smad2 in transforming growth factor-beta signaling.
10890911 2000 Association of Smads with lymphoid enhancer binding factor 1/T cell-specific factor mediates cooperative signaling by the transforming growth factor-beta and wnt pathways.
10887155 2000 A novel smad nuclear interacting protein, SNIP1, suppresses p300-dependent TGF-beta signal transduction.
10863401 1999 cDNA cloning and sequencing of MH2 domain of Smad2 from human dental pulp cells.
10825365 2000 TGFbeta receptor types I and II and the substrate proteins Smad 2 and 3 are present in human oocytes.
10823886 2000 Transforming growth factor beta -inducible independent binding of SMAD to the Smad7 promoter.
10819637 2000 Mutation analysis of SMAD2, SMAD3, and SMAD4 genes in hereditary non-polyposis colorectal.
10757800 2000 STRAP and Smad7 synergize in the inhibition of transforming growth factor beta signaling.
10708949 TGF-beta signaling by Smad proteins.
10708948 The Smad pathway.
10678166 2000 Microtubule binding to Smads may regulate TGF beta activity.
10647776 Remarkable versatility of Smad proteins in the nucleus of transforming growth factor-beta activated cells.
10615055 2000 Structural basis of Smad2 recognition by the Smad anchor for receptor activation.
10549282 1999 Interaction of the Ski oncoprotein with Smad3 regulates TGF-beta signaling.
10531362 1999 Interaction and functional cooperation of PEBP2/CBF with Smads. Synergistic induction of the immunoglobulin germline Calpha promoter.
10531062 1999 Negative feedback regulation of TGF-beta signaling by the SnoN oncoprotein.
10505717 1999 Overexpression of Smad2 and colocalization with TGF-beta1 in human pancreatic cancer.
10485843 1999 The Ski oncoprotein interacts with the Smad proteins to repress TGFbeta signaling.
10420150 1999 Expression and mutational analysis of the MADR2/Smad2 gene in human prostate cancer.
10400677 1999 SIP1, a novel zinc finger/homeodomain repressor, interacts with Smad proteins and binds to 5'-CACCT sequences in candidate target genes.
10220381 1999 Smads bind directly to the Jun family of AP-1 transcription factors.
10199400 1999 A Smad transcriptional corepressor.
10197981 1999 A mechanism of repression of TGFbeta/ Smad signaling by oncogenic Ras.
9892009 1999 Roles of pathway-specific and inhibitory Smads in activin receptor signaling.
9873005 1999 Alternatively spliced variant of Smad2 lacking exon 3. Comparison with wild-type Smad2 and Smad3.
9865696 1998 SARA, a FYVE domain protein that recruits Smad2 to the TGFbeta receptor.
9843199 1998 Carboxy-terminally truncated Gli3 proteins associate with Smads.
9820171 1998 Somatic alterations of the SMAD-2 gene in human colorectal cancers.
9759503 1998 TGF-beta signal transduction.
9732876 1998 Smad3 and Smad4 cooperate with c-Jun/c-Fos to mediate TGF-beta-induced transcription.
9702198 1998 Characterization of human FAST-1, a TGF beta and activin signal transducer.
9702197 1998 Smad2 and Smad3 positively and negatively regulate TGF beta-dependent transcription through the forkhead DNA-binding protein FAST2.
9679056 1998 TGF-beta-stimulated cooperation of smad proteins with the coactivators CBP/p300.
9670020 1998 Smad proteins exist as monomers in vivo and undergo homo- and hetero-oligomerization upon activation by serine/threonine kinase receptors.
9525694 1998 TGF-beta receptors and signalling mechanisms.
9503010 1998 Characterization of the MADH2/Smad2 gene, a human Mad homolog responsible for the transforming growth factor-beta and activin signal transduction pathway.
9436979 1998 Smad6 inhibits BMP/Smad1 signaling by specifically competing with the Smad4 tumor suppressor.
9389648 1997 Dual role of the Smad4/DPC4 tumor suppressor in TGFbeta-inducible transcriptional complexes.
9346908 1997 TbetaRI phosphorylation of Smad2 on Ser465 and Ser467 is required for Smad2-Smad4 complex formation and signaling.
9311995 1997 TGF-beta receptor-mediated signalling through Smad2, Smad3 and Smad4.
9288972 1997 Smad4 and FAST-1 in the assembly of activin-responsive factor.
9256479 1997 Vascular MADs: two novel MAD-related genes selectively inducible by flow in human vascular endothelium.
9214507 1997 Mutations increasing autoinhibition inactivate tumour suppressors Smad2 and Smad4.
9136927 1997 The TGF-beta family mediator Smad1 is phosphorylated directly and activated functionally by the BMP receptor kinase.
9111321 1997 Heteromeric and homomeric interactions correlate with signaling activity and functional cooperativity of Smad3 and Smad4/DPC4.
9092546 1997 Interaction of MAD2 with the carboxyl terminus of the insulin receptor but not with the IGFIR. Evidence for release from the insulin receptor after activation.
9006934 1997 Identification of Smad2, a human Mad-related protein in the transforming growth factor beta signaling pathway.
8980228 1996 MADR2 is a substrate of the TGFbeta receptor and its phosphorylation is required for nuclear accumulation and signaling.
8893010 1996 Partnership between DPC4 and SMAD proteins in TGF-beta signalling pathways.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
8861901 1996 Nomenclature: vertebrate mediators of TGFbeta family signals.
8774881 1996 Receptor-associated Mad homologues synergize as effectors of the TGF-beta response.
8752209 1996 MADR2 maps to 18q21 and encodes a TGFbeta-regulated MAD-related protein that is functionally mutated in colorectal carcinoma.
8673135 1996 Mad-related genes in the human.
8617505 1996 The I.M.A.G.E. Consortium: an integrated molecular analysis of genomes and their expression.