Property Summary

NCBI Gene PubMed Count 179
PubMed Score 5.19
PubTator Score 157.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Gene RIF (96)

PMID Text
27049088 The expression SMAD1 protein showed a significant correlation with lung cancer differentiation and lymphatic metastasis (P < 0.05), but not with genders, ages, tumor sizes and histological types of lung cancer patients (P>0.05).
26776318 Regulation of impaired angiogenesis in diabetic dermal wound healing by microRNA-26a is mediated by the increased expression of its target gene, SMAD1.
26227059 Overexpression of Smad1 is associated with prostate cancer.
25880873 adult human Sertoli cells assumed similar morphological features, stable global gene expression profiles and numerous proteins, and activation of AKT and SMAD1/5 during long-period culture.
25761878 Our data indicated that downregulation of miR-26b in osteosarcoma elevated the levels of CTGF and Smad1, facilitating osteosarcoma metastasis
25757624 Smad1 elevation serves as a compensatory mechanism for p53 deficiency by potentiating the activation of p53 parallel pathways.
25639853 SMAD1 signaling may be a key pathway contributing the pathogenesis of Cardio-facio-cutaneous syndrome during early development.
25505291 balance between Smad1/5- and Smad2/3-dependent signaling defines the outcome of the effect of TGF-beta on atherosclerosis where Smad1/5 is responsible for proatherogenic effects
25010525 Smad1 as a novel binding protein of KSHV latency-associated nuclear antigen (LANA). LANA interacted with and sustained BMP-activated p-Smad1 in the nucleus and enhanced its loading on the Id promoters.
24850914 Data show that USP15 enhances BMP-induced phosphorylation of SMAD1 by interacting with and deubiquitylating ALK3.
24828823 Inhibiting Smurf1 mediated ubiquitination of Smad1/5.
24347165 Glucocorticoids recruit Tgfbr3 and Smad1 to shift transforming growth factor-beta signaling from the Tgfbr1/Smad2/3 axis to the Acvrl1/Smad1 axis in lung fibroblasts.
24021264 the shear-induced apoptosis and autophagy are mediated by bone morphogenetic protein receptor type (BMPR)-IB, BMPR-specific Smad1 and Smad5, and p38 mitogen-activated protein kinase.
24008158 HIV-1 Vif upregulates the expression of SMAD family member 1 (SMAD1) in Vif-expression T cells
23943254 urinary Smad1 may be a potential diagnostic parameter for diabetic nephropathy and may be used to evaluate the severity of diabetic nephropathy
23918166 Results indicate that BMP/Smad signaling pathway was altered during the period of osteogenesis, and that the activities of p-Smad1/5 were required for Saos-2 cells viability and differentiation induced by fluoride.
23804438 a detailed computational model for TGF-beta signalling that incorporates elements of previous models together with crosstalking between Smad1/5/8 and Smad2/3 channels through a negative feedback loop dependent on Smad7.
23800974 Smad1 is directly downregulated by miR-205. mRNA levels are not affected but Smad1 protein is decreased by miR-205 overexpression and increased by miR-205 inhibition.
23734213 Data indicate a transcription complex androgen receptor (AR)-p44-Smad1, and confirmed for physical interaction by co-immunoprecipitaion.
23707512 shows role of ALK-1 in many process related to cardiovascular homeostasis, and the involvement of this protein in the development of cardiovascular diseases, suggesting the possibility of using the ALK-1/smad-1 pathway as a powerful therapeutic target
23387849 Oscillatory shear stress induces synergistic interactions between specific BMPRs and integrin to activate Smad1/5 through the Shc/FAK/ERK pathway
23333304 HIV-1 Vif upregulates the expression of SMAD family member 1 (SMAD1) in Vif-expression T cells
23088614 Immunohistochemical analysis furthermore revealed that phosphorylated Smad1/5/8 and endoglin expression were significantly higher in high-grade compared to low-grade chondrosarcoma and correlated to each other.
22964636 our studies establish that loss of SMAD1/5 leads to upregulation of PDGFA in ovarian granulosa cells
22897816 TNF activated NF-kappaB pathway and inhibited the phosphorylation of Smad 1/5/8 and BMP-2-induced osteoblastic differentiation in BMMSCs
22868198 Immunohistochemical analysis of phosphorylated Smad1 showed nuclear expression in 70% of the osteosarcoma samples at levels comparable to osteoblastoma. Cases with lower expression showed significantly worse disease free survival.
22615489 TGF-beta induces the formation of complexes comprising phosphorylated Smad1/5 and Smad3, which bind to BMP-responsive elements in vitro and in vivo and mediate TGF-beta-induced transcriptional repression.
22550179 Force-specific activation of Smad1/5 regulates vascular endothelial cell cycle progression in response to disturbed flow.
22474288 Smurf1 is a negative feedback regulator for IFN-gamma signaling by targeting STAT1 for ubiquitination and proteasomal degradation.
22452883 Data suggest that Smads 1, 5 and 8 as potential prognostic markers and therapeutic targets for mTOR inhibition therapy of prostate cancer.
22393057 PAK2 negatively modulate TGF-beta signaling by attenuating the receptor-Smad interaction and thus Smad activation
22299030 BMP-9 induced endothelial cell tubule formation and inhibition of migration involves Smad1 driven endothelin-1 production.
22277251 Cav-1 is required and sufficient for Smad1 signaling in human dermal fibroblasts.
22073863 Urinary Smad1 is a sensitive biomarker for diagnosis of diabetic glomerulosclerosis.
21945631 Results show that BMP4-induced changes in OvCa cell morphology and motility are Smad-dependent with shRNA targeting Smads 1, 4, and 5.
21760921 This study defines a novel CCN2/alpha(v)beta(3) integrin/Src/Smad1 axis that contributes to the pro-fibrotic TGF-beta signaling.
21515822 A temporally defined function for Smad1 in restricting the expansion of early hematopoietic progenitors.
21454478 CHIP inhibits the signaling activities of Smad1/5 by recruiting Smad1/5 from the functional R-/Co-Smad complex and further promoting the ubiquitination/degradation of Smad1/5 in a chaperone-independent manner.
21445358 results provide new evidence that the activation of Src/Smad1 signaling pathway plays a key role in the development of glomerulosclerosis in experimental glomerulonephritis
21440420 Caveolin 1 inhibits transforming growth factor-beta1 activity via inhibition of Smad signaling by hypertrophic scar derived fibroblasts in vi
21405981 Expression of mutated Smad1 in adult human MSC cultures also resulted in increased nuclear accumulation of BMP-activated Smads and elevated gene transcripts characteristic of differentiating osteoblasts
21360446 role of Smad1 in diabetic nephropathy [review]
21344387 Endoglin promotes fibrosis in scleroderma fibroblasts via TGF-beta/Smad1 signaling.
21068203 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20734064 Observational study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20565840 High serum TGF-beta is associated with cervical carcinoma.
20522807 Prostacyclin analogues inhibited smooth muscle cell proliferation and prevented progression of pulmonary hypertension while enhancing Smad1/5 phosphorylation and Id1 gene expression.
20460105 BMP6, Smad1, Smad2 mRNA and protein expression were significantly higher in during sickle-cell pathology with orthopedic complications.
20388715 Inflammation anergy in human intestinal macrophages is due to Smad-induced IkappaBalpha expression and NF-kappaB inactivation
19996292 BMP9 acts as a proliferative factor for immortalized ovarian surface epithelial cells and ovarian cancer cell lines, signaling predominantly through an ALK2/Smad1/Smad4 pathway, the major BMP9 receptor in endothelial cells.
19959123 Observational study of gene-disease association. (HuGE Navigator)
19819941 Data suggest that the SMAD family, possibly through disruption of SMAD1/5 or activation of SMAD2/3 may contribute to the pathogenesis of JGCT in humans.
19513897 Decreased phosphorylation of Smad1, induced by decreased BMPR-1B expression, correlated with the malignant grade of human gliomas and a poor prognosis.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19424179 cGKI has a dual function in BMP signalling: (1) it modulates BMP receptor/Smad activity at the plasma membrane and (2) after redistribution to the nucleus, it further regulates transcription as a nuclear co-factor for Smads.
19269967 increases of p16(INK4a) and p21(WAF1/cip1) expression in response to BMP4 were mediated by the Smad1/5/8 signaling pathway.
19247629 Observational study of gene-disease association. (HuGE Navigator)
19244313 5-HT transactivates the serine kinase receptor, BMPR 1A, to activate Smads 1/5/8 via Rho and Rho kinase in in bovine and human pulmonary artery smooth muscle cells
19224917 TGFbeta-mediated Smad1 phosphorylation appears to occur via different receptor complexes in a cell type-specific manner
19211612 Observational study of gene-disease association. (HuGE Navigator)
19056927 BMP signaling, through Smad1 induction and upregulation of MMP-2, is an important mediator of pancreatic cancer invasiveness and a potential therapeutic target for treating this deadly disease.
18775991 Endoglin promotes transforming growth factor beta-mediated Smad 1/5/8 signaling and inhibits endothelial cell migration through its association with GIPC
18769113 TGFbeta activates PI3K to downregulate PTEN for enhancement of cell proliferation that is independent of SMAD proteins
18684712 ALK2(R206H) with Smad1 or Smad5 induced osteoblastic differentiation that could be inhibited by Smad7 or dorsomorphin.
18668566 activation of Smad1 signaling occurs in a subset of SSc patients and contributes to persistent activation of SSc fibroblasts.
18393632 SMAD 2/3 signaling directly supports NANOG expression, while SMAD 1/5/8 activation moderately represses SOX2.
18321803 Data show that the expression of key transcription factors, phosphorylated Smad1 protein, and the nuclear accumulation of Smad1 and Smad4 are inhibited by Ubc9 silencing.
18310319 The shear-induced G(2)/M arrest and corresponding changes in G(2)/M regulatory protein expression and activity were mediated by alpha(v)beta(3) and beta(1) integrins through bone morphogenetic protein receptor type IA-specific Smad1 and Smad5.
18184649 intron 1 of the follistatin gene has a critical role in mediating Smad-dependent effects of activin and regulating the expression level of this gene
17963781 ubiquitination level of pseudo-phosphorylated Smad1 by CHIP is stronger than that of wild-type Smad1 and can be strongly inhibited by a phosphorylated tail of Smad1
17948051 The results illustrate, for the first time, a role for Smad1 in the integration of spatial information and in the niche-size-dependent control of hESC self-renewal and differentiation.
17847004 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17496924 Knockdown of Smad1 increased motility and abrogated endoglin's effects
17455258 DNA microarray and real-time RT-PCR revealed that Smad1 expression was upregulated in MT1-MMP-expressing cells and rapidly growing tumors
17452325 analysis of a novel functional link between Mps1 and Smads in a non-canonical Smad signaling pathway
17392271 WNK1 is a dual modulator of TGFbeta-Smad signaling pathways
17359969 These data suggest autocrine TGF-beta1 antagonizes BMP signaling through modulation of inducible Smad6 and the activity of BMP specific Smad1/5.
17043655 SMAD1(SIP1)is involved in the progression of pancreatic cancer and plays a role in mediating signal transduction from collagen type I to downregulate E-cadherin expression.
16990609 The Smad1 shows a distinctive expression profile as embryonic stem (ES) cells undergo differentiation in the embryoid body (EB) system, with peak levels in cell populations enriched for the hemangioblast.
16931515 PPM1A plays an important role in controlling BMP signaling through catalyzing Smad1 dephosphorylation
16621789 BMP-2 antagonizes Wnt-3a signaling in osteoblast progenitors by promoting an interaction between Smad1 and Dvl-1 that restricts beta-catenin activation
16436528 Human granulosa-like tumor cell line KGN expressed BMP type I (BMPR1A and BMPR1B) and type II receptors (BMPR2) and the BMP signaling molecules SMADs (SMAD1 and SMAD5).
16412560 the PI3-K pathway negatively regulates TGF-beta/Smad signaling in neuroblastoma cells
16326713 Data show that phosphophoryn (PP) up-regulates bone morphogenetic protein 2 gene expression 12 h post-treatment with PP, much later than initial detection of Smad1 phosphorylation at 30 min.
16247476 activation by BMP-2 in lung cancer cells
15911698 Smad1 signaling pathway plays a role in cardioprotection against I/R injury.
15877825 In mature human B cells, BMP-6 inhibited cell growth, and rapidly induced phosphorylation of Smad1.
15613244 MAB21L2 immunoprecipitates in vivo with the BMP4 effector SMAD1, whilst in vitro it binds SMAD1 and the SMAD1-SMAD4 complex
15516492 Antiproliferative and prodifferentiation effects of BMP4 were Smad1 dependent with JNK also contributing to differentiation.
14732718 Smad1 directly regulated transcription for Col4 through the binding of Smad1 to the promoter of Col4.
14701756 CHIP can interact with the Smad1/Smad4 proteins and block BMP signal transduction through the ubiquitin-mediated degradation of Smad proteins.
12821673 a novel nuclear export signal in Smad1 is essential for its signaling activity
12354674 overexpression of adenoviral Smad1 and Smad2 proteins without exogenously added ligands induced inhibin B production
11811554 Stimulation of Smad1 transcriptional activity by Ras-extracellular signal-regulated kinase pathway: a possible mechanism for collagen-dependent osteoblastic differentiation.

AA Sequence

MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRS      1 - 70
LDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYKRVESPVLPPVLV     71 - 140
PRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGSSSSTYPHSPTSS    141 - 210
DPGSPFQMPADTPPPAYLPPEDPMTQDGSQPMDTNMMAPPLPSEINRGDVQAVAYEEPKHWCSIVYYELN    211 - 280
NRVGEAFHASSTSVLVDGFTDPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSD    281 - 350
SSIFVQSRNCNYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGW    351 - 420
GAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS                             421 - 465
//

Text Mined References (185)

PMID Year Title
27049088 Expression profiles of SMAD1 protein in lung cancer tissues and normal tissues and its effect on lung cancer incidence.
26878725 2016 Mutations in nuclear pore genes NUP93, NUP205 and XPO5 cause steroid-resistant nephrotic syndrome.
26776318 2016 Regulation of impaired angiogenesis in diabetic dermal wound healing by microRNA-26a.
26227059 2016 MiR-345 suppresses proliferation, migration and invasion by targeting Smad1 in human prostate cancer.
25880873 2015 Long-term culture and significant expansion of human Sertoli cells whilst maintaining stable global phenotype and AKT and SMAD1/5 activation.
25761878 2015 MicroRNA-26b inhibits metastasis of osteosarcoma via targeting CTGF and Smad1.
25757624 2015 P53 deficiency-induced Smad1 upregulation suppresses tumorigenesis and causes chemoresistance in colorectal cancers.
25639853 2015 Enhanced SMAD1 Signaling Contributes to Impairments of Early Development in CFC-iPSCs.
25505291 2015 TGF-?1, but not bone morphogenetic proteins, activates Smad1/5 pathway in primary human macrophages and induces expression of proatherogenic genes.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25010525 2014 Oncogenic herpesvirus KSHV Hijacks BMP-Smad1-Id signaling to promote tumorigenesis.
24850914 2014 USP15 targets ALK3/BMPR1A for deubiquitylation to enhance bone morphogenetic protein signalling.
24828823 2014 Selective small molecule compounds increase BMP-2 responsiveness by inhibiting Smurf1-mediated Smad1/5 degradation.
24554596 2014 Protein associated with SMAD1 (PAWS1/FAM83G) is a substrate for type I bone morphogenetic protein receptors and modulates bone morphogenetic protein signalling.
24412244 2014 Charting the molecular links between driver and susceptibility genes in colorectal cancer.
24347165 2014 Glucocorticoids recruit Tgfbr3 and Smad1 to shift transforming growth factor-? signaling from the Tgfbr1/Smad2/3 axis to the Acvrl1/Smad1 axis in lung fibroblasts.
24021264 2013 Mechanical regulation of cancer cell apoptosis and autophagy: roles of bone morphogenetic protein receptor, Smad1/5, and p38 MAPK.
23943254 2014 Urinary Smad1 is a new biomarker for diagnosis and evaluating the severity of diabetic nephropathy.
23918166 2013 Fluoride promotes viability and differentiation of osteoblast-like Saos-2 cells via BMP/Smads signaling pathway.
23804438 2013 Computational modelling of Smad-mediated negative feedback and crosstalk in the TGF-? superfamily network.
23800974 2013 MiR-205 is downregulated in hereditary hemorrhagic telangiectasia and impairs TGF-beta signaling pathways in endothelial cells.
23734213 2013 Functional domains of androgen receptor coactivator p44/Mep50/WDR77and its interaction with Smad1.
23707512 2013 The ALK-1/Smad1 pathway in cardiovascular physiopathology. A new target for therapy?
23610558 2013 Rnf165/Ark2C enhances BMP-Smad signaling to mediate motor axon extension.
23387849 2013 BMP receptor-integrin interaction mediates responses of vascular endothelial Smad1/5 and proliferation to disturbed flow.
23088614 2012 BMP and TGFbeta pathways in human central chondrosarcoma: enhanced endoglin and Smad 1 signaling in high grade tumors.
22964636 2013 BMP-specific SMADs function as novel repressors of PDGFA and modulate its expression in ovarian granulosa cells and tumors.
22897816 2013 Activated NF-?B in bone marrow mesenchymal stem cells from systemic lupus erythematosus patients inhibits osteogenic differentiation through downregulating Smad signaling.
22868198 2012 The activities of Smad and Gli mediated signalling pathways in high-grade conventional osteosarcoma.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22781750 2012 Protein phosphatase 5 modulates SMAD3 function in the transforming growth factor-? pathway.
22615489 2012 Transforming growth factor ? inhibits bone morphogenetic protein-induced transcription through novel phosphorylated Smad1/5-Smad3 complexes.
22550179 2012 Force-specific activation of Smad1/5 regulates vascular endothelial cell cycle progression in response to disturbed flow.
22474288 2012 Smurf1 protein negatively regulates interferon-? signaling through promoting STAT1 protein ubiquitination and degradation.
22452883 2012 Inhibition of mTORC1 kinase activates Smads 1 and 5 but not Smad8 in human prostate cancer cells, mediating cytostatic response to rapamycin.
22393057 2012 p21-Activated kinase 2 (PAK2) inhibits TGF-? signaling in Madin-Darby canine kidney (MDCK) epithelial cells by interfering with the receptor-Smad interaction.
22299030 2012 BMP-9 induced endothelial cell tubule formation and inhibition of migration involves Smad1 driven endothelin-1 production.
22277251 2012 Elevated expression of cav-1 in a subset of SSc fibroblasts contributes to constitutive Alk1/Smad1 activation.
22073863 2011 [BMP4-Smad1 signaling pathway in pathogenesis of diabetic nephropathy].
21947082 2011 USP15 is a deubiquitylating enzyme for receptor-activated SMADs.
21945631 2011 Human ovarian cancer cell morphology, motility, and proliferation are differentially influenced by autocrine TGF? superfamily signalling.
21898662 2011 Molecular genetic characterization of SMAD signaling molecules in pulmonary arterial hypertension.
21760921 2011 CCN2 is required for the TGF-? induced activation of Smad1-Erk1/2 signaling network.
21708152 2011 Binding of RhoA by the C2 domain of E3 ligase Smurf1 is essential for Smurf1-regulated RhoA ubiquitination and cell protrusive activity.
21690388 2011 Smad inhibition by the Ste20 kinase Misshapen.
21515822 2011 Smad1 signaling restricts hematopoietic potential after promoting hemangioblast commitment.
21454478 2011 Molecular mechanism of the negative regulation of Smad1/5 protein by carboxyl terminus of Hsc70-interacting protein (CHIP).
21453705 2011 Ubiquitin C-terminal hydrolase-L3 regulates Smad1 ubiquitination and osteoblast differentiation.
21445358 2011 Activation of Src mediates PDGF-induced Smad1 phosphorylation and contributes to the progression of glomerulosclerosis in glomerulonephritis.
21440420 2011 Caveolin 1 inhibits transforming growth factor-?1 activity via inhibition of Smad signaling by hypertrophic scar derived fibroblasts in vitro.
21405981 2011 Modification of Smad1 linker modulates BMP-mediated osteogenesis of adult human MSC.
21360446 2011 Role of Smad1 in diabetic nephropathy: Molecular mechanisms and implications as a diagnostic marker.
21344387 2011 Endoglin promotes TGF-?/Smad1 signaling in scleroderma fibroblasts.
21269460 2011 Initial characterization of the human central proteome.
21068203 2011 Genetic variation in the TGF-? signaling pathway and colon and rectal cancer risk.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20565840 2010 Alterations of dendritic cell subsets in the peripheral circulation of patients with cervical carcinoma.
20522807 2010 Smad-dependent and smad-independent induction of id1 by prostacyclin analogues inhibits proliferation of pulmonary artery smooth muscle cells in vitro and in vivo.
20460105 2010 Induced expression of bone morphogenetic protein-6 and Smads signaling in human monocytes derived dendritic cells during sickle-cell pathology with orthopedic complications.
20388715 2010 Inflammation anergy in human intestinal macrophages is due to Smad-induced IkappaBalpha expression and NF-kappaB inactivation.
19996292 2009 Autocrine bone morphogenetic protein-9 signals through activin receptor-like kinase-2/Smad1/Smad4 to promote ovarian cancer cell proliferation.
19959123 2009 Association of TGFBR2 polymorphism with risk of sudden cardiac arrest in patients with coronary artery disease.
19914168 2009 Nuclear CDKs drive Smad transcriptional activation and turnover in BMP and TGF-beta pathways.
19819941 2009 Smad1-Smad5 ovarian conditional knockout mice develop a disease profile similar to the juvenile form of human granulosa cell tumors.
19664780 2009 Bone morphogenic protein 2 induces Runx2 and osteopontin expression in human aortic valve interstitial cells: role of Smad1 and extracellular signal-regulated kinase 1/2.
19513897 2009 Expression and functional roles of Smad1 and BMPR-IB in glioma development.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19424179 2009 Novel crosstalk to BMP signalling: cGMP-dependent kinase I modulates BMP receptor and Smad activity.
19269967 2009 BMP4-Smad signaling pathway mediates adriamycin-induced premature senescence in lung cancer cells.
19247629 2009 Investigation of DNA polymorphisms in SMAD genes for genetic predisposition to diabetic nephropathy in patients with type 1 diabetes mellitus.
19244313 2009 Serotonin induces Rho/ROCK-dependent activation of Smads 1/5/8 in pulmonary artery smooth muscle cells.
19224917 2009 Transforming Growth Factor {beta} Can Stimulate Smad1 Phosphorylation Independently of Bone Morphogenic Protein Receptors.
19211612 2009 A new nonsense mutation of SMAD8 associated with pulmonary arterial hypertension.
19056927 2009 Bone morphogenetic proteins induce pancreatic cancer cell invasiveness through a Smad1-dependent mechanism that involves matrix metalloproteinase-2.
19018011 2008 Holding their own: the noncanonical roles of Smad proteins.
18775991 2008 Endoglin promotes transforming growth factor beta-mediated Smad 1/5/8 signaling and inhibits endothelial cell migration through its association with GIPC.
18769113 2008 TGFbeta modulates PTEN expression independently of SMAD signaling for growth proliferation in colon cancer cells.
18684712 2009 Constitutively activated ALK2 and increased SMAD1/5 cooperatively induce bone morphogenetic protein signaling in fibrodysplasia ossificans progressiva.
18668566 2008 Smad1 pathway is activated in systemic sclerosis fibroblasts and is targeted by imatinib mesylate.
18393632 2008 Control of early fate decisions in human ES cells by distinct states of TGFbeta pathway activity.
18321803 2008 Ubc9 promotes the stability of Smad4 and the nuclear accumulation of Smad1 in osteoblast-like Saos-2 cells.
18310319 2008 Tumor cell cycle arrest induced by shear stress: Roles of integrins and Smad.
18184649 2008 A Smad-binding element in intron 1 participates in activin-dependent regulation of the follistatin gene.
18045539 2007 Integrating patterning signals: Wnt/GSK3 regulates the duration of the BMP/Smad1 signal.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17963781 2007 Differential ubiquitination of Smad1 mediated by CHIP: implications in the regulation of the bone morphogenetic protein signaling pathway.
17948051 2007 Niche-mediated control of human embryonic stem cell self-renewal and differentiation.
17847004 2007 Common variants in the BMP2, BMP4, and HJV genes of the hepcidin regulation pathway modulate HFE hemochromatosis penetrance.
17496924 2007 Endoglin inhibits prostate cancer motility via activation of the ALK2-Smad1 pathway.
17455258 2007 Induction of Smad1 by MT1-MMP contributes to tumor growth.
17452325 2007 Activation of Mps1 promotes transforming growth factor-beta-independent Smad signaling.
17392271 2007 Biological cross-talk between WNK1 and the transforming growth factor beta-Smad signaling pathway.
17359969 2007 Antisense targeting of TGF-beta1 augments BMP-induced upregulation of osteopontin, type I collagen and Cbfa1 in human Saos-2 cells.
17356069 2007 Endofin acts as a Smad anchor for receptor activation in BMP signaling.
17292623 2007 Fussel-15, a novel Ski/Sno homolog protein, antagonizes BMP signaling.
17183365 2007 Control of prostate cell growth: BMP antagonizes androgen mitogenic activity with incorporation of MAPK signals in Smad1.
17043655 2007 Collagen type I-induced Smad-interacting protein 1 expression downregulates E-cadherin in pancreatic cancer.
16990609 2007 Smad1 expands the hemangioblast population within a limited developmental window.
16931515 2006 Protein serine/threonine phosphatase PPM1A dephosphorylates Smad1 in the bone morphogenetic protein signaling pathway.
16621789 2006 A dishevelled-1/Smad1 interaction couples WNT and bone morphogenetic protein signaling pathways in uncommitted bone marrow stromal cells.
16436528 2006 Mutual regulation of follicle-stimulating hormone signaling and bone morphogenetic protein system in human granulosa cells.
16412560 2006 Inhibition of transforming growth factor-beta/Smad signaling by phosphatidylinositol 3-kinase pathway.
16326713 2006 Extracellular matrix-mediated signaling by dentin phosphophoryn involves activation of the Smad pathway independent of bone morphogenetic protein.
16247476 2006 Bone morphogenetic protein 2 stimulation of tumor growth involves the activation of Smad-1/5.
15911698 2005 Smad1 protects cardiomyocytes from ischemia-reperfusion injury.
15877825 2005 BMP-6 inhibits growth of mature human B cells; induction of Smad phosphorylation and upregulation of Id1.
15781469 2005 CHIP controls the sensitivity of transforming growth factor-beta signaling by modulating the basal level of Smad3 through ubiquitin-mediated degradation.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15708501 2005 Specific interaction between Smad1 and CHIP: a surface plasmon resonance study.
15647271 2005 The integral inner nuclear membrane protein MAN1 physically interacts with the R-Smad proteins to repress signaling by the transforming growth factor-{beta} superfamily of cytokines.
15621726 2004 Bone morphogenetic proteins.
15613244 2004 MAB21L2, a vertebrate member of the Male-abnormal 21 family, modulates BMP signaling and interacts with SMAD1.
15542835 2004 B-cell translocation gene 2 (Btg2) regulates vertebral patterning by modulating bone morphogenetic protein/smad signaling.
15516492 2005 BMP4 inhibits proliferation and promotes myocyte differentiation of lung fibroblasts via Smad1 and JNK pathways.
15489854 2004 Loss-of-function mutations in LEMD3 result in osteopoikilosis, Buschke-Ollendorff syndrome and melorheostosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15246821 2004 BMP signaling initiates a neural crest differentiation program in embryonic rat CNS stem cells.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14732718 2004 Type IV collagen is transcriptionally regulated by Smad1 under advanced glycation end product (AGE) stimulation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14701756 2004 CHIP mediates degradation of Smad proteins and potentially regulates Smad-induced transcription.
14687659 2004 Signal transduction of bone morphogenetic protein receptors.
14633973 2003 Ecsit is required for Bmp signaling and mesoderm formation during mouse embryogenesis.
14630787 2004 Early hematopoietic zinc finger protein (EHZF), the human homolog to mouse Evi3, is highly expressed in primitive human hematopoietic cells.
14500836 2003 Enhanced gene activation by Notch and BMP signaling cross-talk.
12874272 2003 Requirement of the co-repressor homeodomain-interacting protein kinase 2 for ski-mediated inhibition of bone morphogenetic protein-induced transcriptional activation.
12821673 2003 A novel nuclear export signal in Smad1 is essential for its signaling activity.
12650946 2003 Identification of three novel Smad binding proteins involved in cell polarity.
12649288 2003 Inactivation of menin, the product of the multiple endocrine neoplasia type 1 gene, inhibits the commitment of multipotential mesenchymal stem cells into the osteoblast lineage.
12519765 2003 Chromosomal region maintenance 1 (CRM1)-dependent nuclear export of Smad ubiquitin regulatory factor 1 (Smurf1) is essential for negative regulation of transforming growth factor-beta signaling by Smad7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12426322 2003 Two short segments of Smad3 are important for specific interaction of Smad3 with c-Ski and SnoN.
12370310 2002 Identification of mZnf8, a mouse Krüppel-like transcriptional repressor, as a novel nuclear interaction partner of Smad1.
12354674 2002 Engagement of activin and bone morphogenetic protein signaling pathway Smad proteins in the induction of inhibin B production in ovarian granulosa cells.
12270938 2002 Regulation of Hex gene expression by a Smads-dependent signaling pathway.
12167862 2002 A component of the ARC/Mediator complex required for TGF beta/Nodal signalling.
12097147 2002 A novel link between the proteasome pathway and the signal transduction pathway of the bone morphogenetic proteins (BMPs).
11811554 2002 Stimulation of Smad1 transcriptional activity by Ras-extracellular signal-regulated kinase pathway: a possible mechanism for collagen-dependent osteoblastic differentiation.
11779505 2001 Structural basis of Smad1 activation by receptor kinase phosphorylation.
11700304 2002 Direct binding of Smad1 and Smad4 to two distinct motifs mediates bone morphogenetic protein-specific transcriptional activation of Id1 gene.
11483516 2001 Promoting bone morphogenetic protein signaling through negative regulation of inhibitory Smads.
11451566 2001 The transcriptional role of Smads and FAST (FoxH1) in TGFbeta and activin signalling.
11438941 2001 Dendritic growth induced by BMP-7 requires Smad1 and proteasome activity.
11387330 2001 Functional cloning of the proto-oncogene brain factor-1 (BF-1) as a Smad-binding antagonist of transforming growth factor-beta signaling.
11278251 2001 Smurf1 interacts with transforming growth factor-beta type I receptor through Smad7 and induces receptor degradation.
11239394 2001 Neurogenin promotes neurogenesis and inhibits glial differentiation by independent mechanisms.
11163184 2000 Negative regulation of BMP/Smad signaling by Tob in osteoblasts.
11158580 2001 Regulation of Smad degradation and activity by Smurf2, an E3 ubiquitin ligase.
11139569 2001 Transcriptional mechanisms of bone morphogenetic protein-induced osteoprotegrin gene expression.
11121043 2000 Ski represses bone morphogenic protein signaling in Xenopus and mammalian cells.
11118211 2000 A novel ability of Smad3 to regulate proteasomal degradation of a Cas family member HEF1.
11016919 2000 Smurf2 is a ubiquitin E3 ligase mediating proteasome-dependent degradation of Smad2 in transforming growth factor-beta signaling.
10890911 2000 Association of Smads with lymphoid enhancer binding factor 1/T cell-specific factor mediates cooperative signaling by the transforming growth factor-beta and wnt pathways.
10887155 2000 A novel smad nuclear interacting protein, SNIP1, suppresses p300-dependent TGF-beta signal transduction.
10708949 TGF-beta signaling by Smad proteins.
10708948 The Smad pathway.
10673036 1999 Activation of Smad1-mediated transcription by p300/CBP.
10660046 2000 OAZ uses distinct DNA- and protein-binding zinc fingers in separate BMP-Smad and Olf signaling pathways.
10652350 2000 Smad and AML proteins synergistically confer transforming growth factor beta1 responsiveness to human germ-line IgA genes.
10647776 Remarkable versatility of Smad proteins in the nucleus of transforming growth factor-beta activated cells.
10583507 1999 Smad8B, a Smad8 splice variant lacking the SSXS site that inhibits Smad8-mediated signalling.
10400705 1999 Interaction of Smad complexes with tripartite DNA-binding sites.
10400677 1999 SIP1, a novel zinc finger/homeodomain repressor, interacts with Smad proteins and binds to 5'-CACCT sequences in candidate target genes.
10224145 1999 Smad1 interacts with homeobox DNA-binding proteins in bone morphogenetic protein signaling.
10205054 1999 Synergistic signaling in fetal brain by STAT3-Smad1 complex bridged by p300.
10085121 1999 MEKK-1, a component of the stress (stress-activated protein kinase/c-Jun N-terminal kinase) pathway, can selectively activate Smad2-mediated transcriptional activation in endothelial cells.
9843199 1998 Carboxy-terminally truncated Gli3 proteins associate with Smads.
9759503 1998 TGF-beta signal transduction.
9748228 1998 Specific activation of Smad1 signaling pathways by the BMP7 type I receptor, ALK2.
9436979 1998 Smad6 inhibits BMP/Smad1 signaling by specifically competing with the Smad4 tumor suppressor.
9393997 1997 TGF-beta signalling from cell membrane to nucleus through SMAD proteins.
9389648 1997 Dual role of the Smad4/DPC4 tumor suppressor in TGFbeta-inducible transcriptional complexes.
9335505 1997 Smad6 inhibits signalling by the TGF-beta superfamily.
9335504 1997 Opposing BMP and EGF signalling pathways converge on the TGF-beta family mediator Smad1.
9136927 1997 The TGF-beta family mediator Smad1 is phosphorylated directly and activated functionally by the BMP receptor kinase.
9111321 1997 Heteromeric and homomeric interactions correlate with signaling activity and functional cooperativity of Smad3 and Smad4/DPC4.
9006934 1997 Identification of Smad2, a human Mad-related protein in the transforming growth factor beta signaling pathway.
8893010 1996 Partnership between DPC4 and SMAD proteins in TGF-beta signalling pathways.
8774881 1996 Receptor-associated Mad homologues synergize as effectors of the TGF-beta response.
8673135 1996 Mad-related genes in the human.
8663601 1996 Serine phosphorylation, chromosomal localization, and transforming growth factor-beta signal transduction by human bsp-1.
8653785 1996 MADR1, a MAD-related protein that functions in BMP2 signaling pathways.
8637600 1996 A human Mad protein acting as a BMP-regulated transcriptional activator.