Property Summary

NCBI Gene PubMed Count 38
PubMed Score 54.86
PubTator Score 42.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.736 6.9e-08

Gene RIF (32)

PMID Text
26453996 SLX4 (FANCP) and XPF (FANCQ) proteins interact with each other and play a vital role in the Fanconi anemia (FA) DNA repair pathway. Study has revealed that the global minor allele, SLX4(Y546C), is defective in this interaction.
25722289 SUMOylation and PARylation cooperate to recruit and stabilize SLX4 at DNA damage sites.
25533188 The SLX4 complex is a SUMO E3 ligase that SUMOylates SLX4 itself and the XPF subunit of the DNA repair/recombination XPF-ERCC1 endonuclease.
25533185 The interactions of SLX4 with SUMO and ubiquitin increase its affinity for factors recognizing different DNA lesions or telomeres, helping to direct the SLX4 complex in distinct functional contexts.
25496524 Vpr recruits the SLX4 endonuclease complex and Vpr-induced inappropriate activation of this complex leads to cell cycle arrest at the G2 phase.
25496524 HIV-1 Vpr-mediated cell cycle G2/M arrest requires human SLX4, MUS81, and EME1 proteins in cells
25320300 HIV-1 Vpr-mediated cell cycle G2/M arrest requires human SLX4, MUS81, and EME1 proteins in cells
25224045 Identification and characterization of MUS81 point mutations that abolish interaction with the SLX4 scaffold protein.
24938228 FANCP has versatile functions in genome maintenance, its mutations result in Fanconi anemia. (Review)
24795708 HIV-1 Vpr-mediated cell cycle G2/M arrest requires human SLX4, MUS81, and EME1 proteins in cells
24794496 Data shed light on SLX4 recruitment, and they point to the existence of currently unidentified ubiquitylated ligands and E3 ligases that are crucial for ICL repair.
24744753 HIV-1 Vpr-mediated cell cycle G2/M arrest requires human SLX4, MUS81, and EME1 proteins in cells
24528857 HIV-1 Vpr-mediated cell cycle G2/M arrest requires human SLX4, MUS81, and EME1 proteins in cells
24412650 Direct interaction of Vpr with SLX4 induced the recruitment of VPRBP and kinase-active PLK1, enhancing the cleavage of DNA by SLX4-associated MUS81-EME1 endonucleases and show that the SLX4com is involved in suppressing spontaneous and HIV-1-mediated induction of type 1 interferon and establishment of antiviral responses.
24412650 HIV-1 Vpr-mediated cell cycle G2/M arrest requires human SLX4, MUS81, and EME1 proteins in cells
24080495 GEN1 activity cannot be substituted for the SLX4-associated nucleases, and one of the HJ resolvase activities, either of those associated with SLX4 or with GEN1, is required for cell viability, even in the presence of BLM.
24076221 Data show that three structure-selective endonucleases, SLX1-SLX4, MUS81-EME1, and GEN1, define two pathways of Holliday junctions (HJs) resolution in HeLa cells.
24012755 SLX4 assembles an endonuclease toolkit that negatively regulates telomere length via SLX1-catalyzed nucleolytic resolution of telomere DNA structures.
23994477 Most, but not all, SLX4 foci localize to telomeres in a range of human cell lines irrespective of the mechanisms used to maintain telomere length.
23211700 Data indicate that SLX4 mutation screening will have a very low impact (if any) in the genetic counseling of non-BRCA1/2 families.
23093618 SLX4-dependent XPF-ERCC1 activity is needed for interstrand cross-linking repair. MUS81-SLX4 interaction is critical for resistance to TOP1 inhibitors.SLX4 interacts with XPF-ERCC1, MUS81-EME1, & SLX1 via MLR, SAP, & SBD domains, respectively.
22911665 Data indicate that germline mutations in SLX4 are very rare and are unlikely to make a significant contribution to familial breast cancer.
22907656 The nuclease hSNM1B/Apollo is linked to the Fanconi anemia pathway via its interaction with FANCP/SLX4.
22401137 Mutational analysis of SLX4 in Breast Cancer cases without mutations in BRCA1 or BRCA2 revealed extensive genetic variation. Twenty-nine novel single nucleotide variants were detected, however, none can be linked to alteration of the protein function.
22383991 Sequencing analysis of SLX4/FANCP gene in Italian familial breast cancer cases
21805310 there is no evidence for a major role of SLX4 coding variants in the inherited susceptibility towards breast cancer in German and Byelorussian patients.
21240277 SLX4, a coordinator of structure-specific endonucleases, is mutated in a new Fanconi anemia subtype
21240275 biallelic mutations in SLX4 (renamed here as FANCP) cause a new subtype of Fanconi anemia, Fanconi anemia-P
19596236 show that SLX4 binds the XPF(ERCC4) and MUS81 subunits of the XPF-ERCC1 and MUS81-EME1 endonucleases and is required for DNA interstrand crosslink repair.
19596236 Study reports the identification of Slx4 orthologs in metazoa, including fly MUS312, essential for meiotic recombination, and human BTBD12, an ATM/ATR checkpoint kinase.
19596235 BTBD12/SLX4 was identified as the human ortholog of yeast DNA repair factor Slx4p and Drosophila MUS312; SLX4 assembles a modular toolkit for repair of specific types of DNA lesions and is critical for cellular responses to replication fork failure.
19595722 Genetic and biochemical evidence suggest that MUS312 and BTBD12 direct Holliday junction resolution by at least two distinct endonucleases in different recombination and repair contexts.

AA Sequence

MKLSVNEAQLGFYLGSLSHLSACPGIDPRSSEDQPESLKTGQMMDESDEDFKELCASFFQRVKKHGIKEV      1 - 70
SGERKTQKAASNGTQIRSKLKRTKQTATKTKTLQGPAEKKPPSGSQAPRTKKQRVTKWQASEPAHSVNGE     71 - 140
GGVLASAPDPPVLRETAQNTQTGNQQEPSPNLSREKTRENVPNSDSQPPPSCLTTAVPSPSKPRTAQLVL    141 - 210
QRMQQFKRADPERLRHASEECSLEAAREENVPKDPQEEMMAGNVYGLGPPAPESDAAVALTLQQEFARVG    211 - 280
ASAHDDSLEEKGLFFCQICQKNLSAMNVTRREQHVNRCLDEAEKTLRPSVPQIPECPICGKPFLTLKSRT    281 - 350
SHLKQCAVKMEVGPQLLLQAVRLQTAQPEGSSSPPMFSFSDHSRGLKRRGPTSKKEPRKRRKVDEAPSED    351 - 420
LLVAMALSRSEMEPGAAVPALRLESAFSERIRPEAENKSRKKKPPVSPPLLLVQDSETTGRQIEDRVALL    421 - 490
LSEEVELSSTPPLPASRILKEGWERAGQCPPPPERKQSFLWEGSALTGAWAMEDFYTARLVPPLVPQRPA    491 - 560
QGLMQEPVPPLVPPEHSELSERRSPALHGTPTAGCGSRGPSPSASQREHQALQDLVDLAREGLSASPWPG    561 - 630
SGGLAGSEGTAGLDVVPGGLPLTGFVVPSQDKHPDRGGRTLLSLGLLVADFGAMVNNPHLSDVQFQTDSG    631 - 700
EVLYAHKFVLYARCPLLIQYVNNEGFSAVEDGVLTQRVLLGDVSTEAARTFLHYLYTADTGLPPGLSSEL    701 - 770
SSLAHRFGVSELVHLCEQVPIATDSEGKPWEEKEAENCESRAENFQELLRSMWADEEEEAETLLKSKDHE    771 - 840
EDQENVNEAEMEEIYEFAATQRKLLQEERAAGAGEDADWLEGGSPVSGQLLAGVQVQKQWDKVEEMEPLE    841 - 910
PGRDEAATTWEKMGQCALPPPQGQHSGARGAEAPEQEAPEEALGHSSCSSPSRDCQAERKEGSLPHSDDA    911 - 980
GDYEQLFSSTQGEISEPSQITSEPEEQSGAVRERGLEVSHRLAPWQASPPHPCRFLLGPPQGGSPRGSHH    981 - 1050
TSGSSLSTPRSRGGTSQVGSPTLLSPAVPSKQKRDRSILTLSKEPGHQKGKERRSVLECRNKGVLMFPEK   1051 - 1120
SPSIDLTQSNPDHSSSRSQKSSSKLNEEDEVILLLDSDEELELEQTKMKSISSDPLEEKKALEISPRSCE   1121 - 1190
LFSIIDVDADQEPSQSPPRSEAVLQQEDEGALPENRGSLGRRGAPWLFCDRESSPSEASTTDTSWLVPAT   1191 - 1260
PLASRSRDCSSQTQISSLRSGLAVQAVTQHTPRASVGNREGNEVAQKFSVIRPQTPPPQTPSSCLTPVSP   1261 - 1330
GTSDGRRQGHRSPSRPHPGGHPHSSPLAPHPISGDRAHFSRRFLKHSPPGPSFLNQTPAGEVVEVGDSDD   1331 - 1400
EQEVASHQANRSPPLDSDPPIPIDDCCWHMEPLSPIPIDHWNLERTGPLSTSSPSRRMNEAADSRDCRSP   1401 - 1470
GLLDTTPIRGSCTTQRKLQEKSSGAGSLGNSRPSFLNSALWDVWDGEEQRPPETPPPAQMPSAGGAQKPE   1471 - 1540
GLETPKGANRKKNLPPKVPITPMPQYSIMETPVLKKELDRFGVRPLPKRQMVLKLKEIFQYTHQTLDSDS   1541 - 1610
EDESQSSQPLLQAPHCQTLASQTYKPSRAGVHAQQEATTGPGAHRPKGPAKTKGPRHQRKHHESITPPSR   1611 - 1680
SPTKEAPPGLNDDAQIPASQESVATSVDGSDSSLSSQSSSSCEFGAAFESAGEEEGEGEVSASQAAVQAA   1681 - 1750
DTDEALRCYIRSKPALYQKVLLYQPFELRELQAELRQNGLRVSSRRLLDFLDTHCITFTTAATRREKLQG   1751 - 1820
RRRQPRGKKKVERN                                                           1821 - 1834
//

Text Mined References (48)

PMID Year Title
27084631 2016 Disruption of SLX4-MUS81 Function Increases the Relative Biological Effectiveness of Proton Radiation.
26453996 2015 Physical interaction between SLX4 (FANCP) and XPF (FANCQ) proteins and biological consequences of interaction-defective missense mutations.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25722289 2015 SUMOylation and PARylation cooperate to recruit and stabilize SLX4 at DNA damage sites.
25533188 2015 The SLX4 complex is a SUMO E3 ligase that impacts on replication stress outcome and genome stability.
25533185 2015 Noncovalent interactions with SUMO and ubiquitin orchestrate distinct functions of the SLX4 complex in genome maintenance.
25496524 2014 How SLX4 cuts through the mystery of HIV-1 Vpr-mediated cell cycle arrest.
25416956 2014 A proteome-scale map of the human interactome network.
25224045 2014 Identification and characterization of MUS81 point mutations that abolish interaction with the SLX4 scaffold protein.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24938228 2014 Nuclease delivery: versatile functions of SLX4/FANCP in genome maintenance.
24794496 2014 Distinct functional roles for the two SLX4 ubiquitin-binding UBZ domains mutated in Fanconi anemia.
24412650 2014 Premature activation of the SLX4 complex by Vpr promotes G2/M arrest and escape from innate immune sensing.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24080495 2013 Human GEN1 and the SLX4-associated nucleases MUS81 and SLX1 are essential for the resolution of replication-induced Holliday junctions.
24076221 2013 Coordinated actions of SLX1-SLX4 and MUS81-EME1 for Holliday junction resolution in human cells.
24012755 2013 SLX4 assembles a telomere maintenance toolkit by bridging multiple endonucleases with telomeres.
23994477 2013 Localization-dependent and -independent roles of SLX4 in regulating telomeres.
23361013 2013 FBH1 co-operates with MUS81 in inducing DNA double-strand breaks and cell death following replication stress.
23211700 2013 Low prevalence of SLX4 loss-of-function mutations in non-BRCA1/2 breast and/or ovarian cancer families.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23093618 2013 Regulation of multiple DNA repair pathways by the Fanconi anemia protein SLX4.
22911665 2013 Analysis of the novel fanconi anemia gene SLX4/FANCP in familial breast cancer cases.
22907656 2012 The nuclease hSNM1B/Apollo is linked to the Fanconi anemia pathway via its interaction with FANCP/SLX4.
22401137 2012 Analysis of SLX4/FANCP in non-BRCA1/2-mutated breast cancer families.
22383991 2012 Sequencing analysis of SLX4/FANCP gene in Italian familial breast cancer cases.
21805310 2011 Mutation analysis of the SLX4/FANCP gene in hereditary breast cancer.
21240277 2011 SLX4, a coordinator of structure-specific endonucleases, is mutated in a new Fanconi anemia subtype.
21240275 2011 Mutations of the SLX4 gene in Fanconi anemia.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19596236 2009 Human SLX4 is a Holliday junction resolvase subunit that binds multiple DNA repair/recombination endonucleases.
19596235 2009 Mammalian BTBD12/SLX4 assembles a Holliday junction resolvase and is required for DNA repair.
19595722 2009 Drosophila MUS312 and the vertebrate ortholog BTBD12 interact with DNA structure-specific endonucleases in DNA repair and recombination.
19595721 2009 Coordination of structure-specific nucleases by human SLX4/BTBD12 is required for DNA repair.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11853319 2001 Prediction of the coding sequences of unidentified human genes. XXII. The complete sequences of 50 new cDNA clones which code for large proteins.
11347906 2001 Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.