Property Summary

NCBI Gene PubMed Count 39
PubMed Score 125.72
PubTator Score 202.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Keratoderma, Palmoplantar 3 0.0 0.0
Disease Target Count
Meleda Disease 1
Palmoplantar keratosis 74
Disease Target Count P-value
psoriasis 6694 6.9e-04
Atopic dermatitis 952 3.6e-03
esophageal adenocarcinoma 737 1.8e-02
Disease Target Count Z-score Confidence
Keratosis 37 6.296 3.1
Prostate carcinoma in situ 11 3.235 1.6
Brachydactyly 156 3.122 1.6
Disease Target Count
Mal de Meleda 7

Expression

  Differential Expression (3)

Disease log2 FC p
Atopic dermatitis -1.900 3.6e-03
esophageal adenocarcinoma -4.400 1.8e-02
psoriasis 1.300 6.9e-04

Gene RIF (27)

AA Sequence

MASRWAVQLLLVAAWSMGCGEALKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVT      1 - 70
RSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL                                          71 - 103
//

Text Mined References (45)

PMID Year Title