Property Summary

NCBI Gene PubMed Count 19
PubMed Score 19.31
PubTator Score 40.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
Weight Gain 87
Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 6.8e-06
osteosarcoma 7933 3.3e-05
ovarian cancer 8491 1.2e-03
glioblastoma 5572 1.3e-03
medulloblastoma, large-cell 6234 2.5e-03
spina bifida 1064 4.8e-02

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.769 3.3e-05
atypical teratoid / rhabdoid tumor -1.500 6.8e-06
glioblastoma -1.400 1.3e-03
medulloblastoma, large-cell -1.400 2.5e-03
spina bifida -1.115 4.8e-02
ovarian cancer -1.100 1.2e-03

Protein-protein Interaction (8)

Gene RIF (7)

PMID Text
24865429 SLU7 knockdown in liver cells resulted in profound changes in pre-mRNA splicing and gene expression, leading to impaired glucose and lipid metabolism, refractoriness to key metabolic hormones, and reversion to a fetal-like gene expression pattern.
23754748 These observations together point to an altered recruitment and dependence on SLU7, suggesting its role in facilitating transitions that promote catalysis, and highlight the diversity in spliceosome assembly.
21122810 RBM22 and hSlu7 differ significantly in their subcellular distributions under stress conditions, and RBM22 enhances the cytoplasmic translocation of hSlu7 under stress.
18854154 Knockdown of SLU7 splicing factor homolog (SLU7) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
17804646 Regulation of transcription of the RNA splicing factor hSlu7 by Elk-1 and Sp1 affects alternative splicing
15728250 hSlu7 has a broad effect on alternative splicing
15181151 The zinc-knuckle motif of hSlu7 determines the cellular localization of the protein through a nucleocytoplasmic-sensitive shuttling balance.

AA Sequence

MSATVVDAVNAAPLSGSKEMSLEEPKKMTREDWRKKKELEEQRKLGNAPAEVDEEGKDINPHIPQYISSV      1 - 70
PWYIDPSKRPTLKHQRPQPEKQKQFSSSGEWYKRGVKENSIITKYRKGACENCGAMTHKKKDCFERPRRV     71 - 140
GAKFTGTNIAPDEHVQPQLMFDYDGKRDRWNGYNPEEHMKIVEEYAKVDLAKRTLKAQKLQEELASGKLV    141 - 210
EQANSPKHQWGEEEPNSQMEKDHNSEDEDEDKYADDIDMPGQNFDSKRRITVRNLRIREDIAKYLRNLDP    211 - 280
NSAYYDPKTRAMRENPYANAGKNPDEVSYAGDNFVRYTGDTISMAQTQLFAWEAYDKGSEVHLQADPTKL    281 - 350
ELLYKSFKVKKEDFKEQQKESILEKYGGQEHLDAPPAELLLAQTEDYVEYSRHGTVIKGQERAVACSKYE    351 - 420
EDVKIHNHTHIWGSYWKEGRWGYKCCHSFFKYSYCTGEAGKEIVNSEECIINEITGEESVKKPQTLMELH    421 - 490
QEKLKEEKKKKKKKKKKHRKSSSDSDDEEKKHEKLKKALNAEEARLLHVKETMQIDERKRPYNSMYETRE    491 - 560
PTEEEMEAYRMKRQRPDDPMASFLGQ                                                561 - 586
//

Text Mined References (30)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24865429 2014 Splicing regulator SLU7 is essential for maintaining liver homeostasis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23754748 2013 Splicing functions and global dependency on fission yeast slu7 reveal diversity in spliceosome assembly.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21122810 2011 Stress induced subcellular distribution of ALG-2, RBM22 and hSlu7.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17804646 2007 Regulation of transcription of the RNA splicing factor hSlu7 by Elk-1 and Sp1 affects alternative splicing.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15728250 2005 Stress alters the subcellular distribution of hSlu7 and thus modulates alternative splicing.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15181151 2004 Splicing factor hSlu7 contains a unique functional domain required to retain the protein within the nucleus.
12764196 2003 The birth of an alternatively spliced exon: 3' splice-site selection in Alu exons.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11991638 2002 Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis.
11238888 2001 An upstream AG determines whether a downstream AG is selected during catalytic step II of splicing.
10647016 1999 The RNA splicing factor hSlu7 is required for correct 3' splice-site choice.
10197984 1999 Human step II splicing factor hSlu7 functions in restructuring the spliceosome between the catalytic steps of splicing.