Property Summary

NCBI Gene PubMed Count 20
PubMed Score 19.40
PubTator Score 40.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Weight Gain 100 0.0 0.0
Disease Target Count P-value
atypical teratoid / rhabdoid tumor 5112 6.8e-06
ovarian cancer 8520 1.2e-03
glioblastoma 5792 1.3e-03
medulloblastoma, large-cell 6241 2.5e-03
osteosarcoma 7950 2.7e-03
spina bifida 1074 4.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Neuronal ceroid lipofuscinosis 1 15 3.295 1.6

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.500 6.8e-06
glioblastoma -1.400 1.3e-03
medulloblastoma, large-cell -1.400 2.5e-03
osteosarcoma -1.129 2.7e-03
ovarian cancer -1.100 1.2e-03
spina bifida -1.115 4.8e-02

Gene RIF (8)

AA Sequence

MSATVVDAVNAAPLSGSKEMSLEEPKKMTREDWRKKKELEEQRKLGNAPAEVDEEGKDINPHIPQYISSV      1 - 70
PWYIDPSKRPTLKHQRPQPEKQKQFSSSGEWYKRGVKENSIITKYRKGACENCGAMTHKKKDCFERPRRV     71 - 140
GAKFTGTNIAPDEHVQPQLMFDYDGKRDRWNGYNPEEHMKIVEEYAKVDLAKRTLKAQKLQEELASGKLV    141 - 210
EQANSPKHQWGEEEPNSQMEKDHNSEDEDEDKYADDIDMPGQNFDSKRRITVRNLRIREDIAKYLRNLDP    211 - 280
NSAYYDPKTRAMRENPYANAGKNPDEVSYAGDNFVRYTGDTISMAQTQLFAWEAYDKGSEVHLQADPTKL    281 - 350
ELLYKSFKVKKEDFKEQQKESILEKYGGQEHLDAPPAELLLAQTEDYVEYSRHGTVIKGQERAVACSKYE    351 - 420
EDVKIHNHTHIWGSYWKEGRWGYKCCHSFFKYSYCTGEAGKEIVNSEECIINEITGEESVKKPQTLMELH    421 - 490
QEKLKEEKKKKKKKKKKHRKSSSDSDDEEKKHEKLKKALNAEEARLLHVKETMQIDERKRPYNSMYETRE    491 - 560
PTEEEMEAYRMKRQRPDDPMASFLGQ                                                561 - 586
//

Text Mined References (32)

PMID Year Title