Property Summary

NCBI Gene PubMed Count 107
PubMed Score 434.24
PubTator Score 486.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
malignant mesothelioma -1.400 6.8e-06
glioblastoma multiforme 1.200 4.6e-05
osteosarcoma -3.251 1.2e-04
posterior fossa group A ependymoma 1.700 2.1e-03
acute quadriplegic myopathy 4.510 4.3e-13
primary pancreatic ductal adenocarcinoma 2.286 1.1e-02
non-small cell lung cancer -1.904 8.2e-12
intraductal papillary-mucinous adenoma (... 1.700 3.0e-02
intraductal papillary-mucinous neoplasm ... 2.600 2.7e-02
lung cancer -7.300 1.4e-07
active Crohn's disease 1.704 1.2e-02
active ulcerative colitis 2.387 8.6e-04
pancreatic cancer 2.700 2.3e-08
breast carcinoma -2.000 3.6e-03
interstitial cystitis -1.700 9.5e-03
lung adenocarcinoma -2.700 4.4e-06
adult high grade glioma 1.400 3.5e-04
psoriasis 1.300 1.6e-08
nasopharyngeal carcinoma -3.300 8.0e-06
lung carcinoma -2.900 1.8e-29
Breast cancer -2.200 1.5e-05
ovarian cancer 3.400 8.7e-05
pituitary cancer -4.600 5.3e-05

Gene RIF (85)

PMID Text
26555393 Ongoing herpes simplex virus infection and resultant downregulation of local levels of SLPI may impart a greater susceptibility for keratinocytes to human papillomavirus type 16 infection through the host cell receptor annexin A2.
26239418 These results demonstrate that SLPI down-regulates pIgR expression through the NF-kappaB signaling pathway by inhibiting degradation of IkappaBbeta protein.
26121748 study identifies a distinct immune response in SA characterized by a dysregulated IFN-gamma/SLPI axis that affects lung function.
25917460 findings support a controlling role for SLPI in NET generation, which is of potential relevance to infectious and autoinflammatory diseases
25851169 Bronchial epithelial cells have decreased SLPI expression in response to hypoxia.
25559229 The elevations in cervical elafin and SLPI expression in the women with preterm delivery might reflect the local response to the pathogen invasion into the cervix preceding preterm labor.
25319722 Abnormal over-expression of SLPI in pancreatic cancer cells may be associated with the development of disease through its roles in promoting cancer cell survival and proliferation as well as anti-apoptosis.
25056659 We identify SLPI as a new player in acquisition of microbial hyporesponsiveness by buccal and intestinal epithelium in the first weeks after microbial colonisation.
25041028 Studies suggest that secretory leukocyte protease inhibitor (SLPI) as a mediator of systemic immune paresis in acute liver failure (ALF).
24764155 SLPI is an independent predictor for both OS and DSS and a relevant prognostic biomarker in OSCC.
24606882 These results show that Mycobacterium tuberculosis-induced IFN-gamma down-modulated SLPI levels by signaling through the IFN-gammaR in healthy donors.
24352879 These results indicate that SLPI controls the proliferation, differentiation, and cell cycle of myeloid cells.
24282288 findings demonstrate that SLPI plays an important role from the initial stages of lung carcinogenesis to the progression of lung cancer in an NF-kappaB-dependent manner
24121782 Both mRNA and protein levels of SLPI were significantly higher in patients with biofilm associated chronic rhinosinusitis (CRS) than those with CRS and no biofilm and controls.
24073410 The aim of this study was to investigate the intracellular function of SLPI and the mechanism-based modulation of neutrophil function by this antiprotease.
24023032 Report presence of SLPI in vaginal secretions and its regulation in response to vaginal microbiota and to the concentrations of antimicrobial and proinflammatory mediators.
23996702 Low SLPI expression is associated with papillomavirus infected head and neck squamous cell carcinomas.
22786767 SLPI may contribute to psoriasis by enabling pDCs to sense extracellular DNA and produce IFN type I.
22537232 SLPI is bactericidal for gonococci and is expressed by reproductive tract epithelial cells and thus is likely to play a role in the pathogenesis of gonococcal infection.
22493362 confirmed that SLPI is significantly down-regulated in NPC tissues. In addition, based on our preliminary results, we propose that the reduction of SLPI in NPC cells is associated with the presence of the EBV genome and/or expression of EBV-encoded genes
21940052 decreased expression in female reproductive tract in postmenopausal women with hormonal treatment
21687932 Results show that SLPI promotes the metastasis of SNU638 gastric cancer cells by increasing MMP-2 and MMP-9 expression through Elk-1 signaling, indicating its role as a signaling molecule not a protease inhibitor.
21676452 SLPI stimulates ovarian cancer invasion, modulated in part by its serine protease inhibitory activity attenuating MMP-9 release.
21641406 SLPI may possess antitumorigenic activity by virtue of its ability to interfere with multiple requisite proteolytic steps underlying tumor cell invasion.
21503571 The results presented here clearly indicate the repression of SLPI, measurable on both, mRNA and protein levels in metastatic primary HNSCC as compared to non-metastatic HNSCC.
21377455 Circulating SLPI increases with progressive metabolic dysfunction and is related to metabolic and inflammatory parameters in men
21335488 Constitutive expression of SLPI directly reduces the inflammatory response in the respiratory tract and improves lung function in an acute model of allergic asthma in SLPI transgenic and knockout mice.
21077989 these findings indicate upregulation of SLPI in response to LPS in nasal secretions and show anti-apoptotic effects of SLPI in primary human neutrophils suggesting a new role of SLPI during neutrophilic inflammation.
20378727 17Beta-estradiol inhibits IL-8 in cystic fibrosis by up-regulating secretory leucoprotease inhibitor
20068074 Secretory leukocyte protease inhibitor antagonizes paclitaxel in ovarian cancer cells, and contribute to drug resistance.
20047904 Using transgenic mice over-expressing secretory leukocyte protease inhibitor, this study shows an early protective effect after spinal cord contusion injury.
19900269 Our observations are the first to implicate SPARC, SLPI, and NLRP2, a component of the innate immune system, in the pathogenesis of axial spondyloarthropathy
19333378 SLPI is a ligand for PLSCR1 and PLSCR4, which also interact directly with the CD4 receptor at the cell surface of T lymphocytes
19271144 Results compare the correlation between H1-receptor expression and SLPI levels within cultured amniotic epithelial cells derived from chorioamnionitis-complicated and normal pregnancies.
19254589 SLPI was expressed in human myometrium and increased after the onset of labor
19154415 This study describes a protease inhibitor-independent function for SLPI in ovarian cancer growth and dissemination.
19095674 SLPI and elafin have a role in the innate immune defence of the Fallopian tube in infection and ectopic pregnancy
19039956 Chlamydia trachomatis and Chlamydophila abortus were found to induce SLPI mRNA and peptide expression in HeLa and JEG-3 cells respectively.
18976018 hK7 and ALP were decreased in malignant prostate epithelium.
18953959 SLPI inhibited the expression of MMP-9 and IL-8 in normal human bronchial epithelial cells induced by cigarette smoke extract.
18688858 SLPI mRNA transcripts and protein were overexpressed in gastric cancer cells, and the depth of wall invasion was significantly greater in serosa-invading (T3 and T4) cancers compared to the serosa-free (T1 and T2) cancers.
18667508 Herpes simplex virus 1 and 2 downregulate secretory leukocyte protease inhibitor through a novel immune evasion mechanism
18425362 Secretory leukoprotease inhibitor inhibits cell growth through apoptotic pathway on ovarian cancer
18285402 Neutrophil-derived SLPI protects secondary granule proteins against proteolytic activation and/or degradation by proteases.
18173453 There was higher expression of SLPI in AIDS patients with CMV infection compared with all groups. There were no differences between controls and AIDS patients without histologic changes with chronic nonspecific sialadenitis or mycobacterial infection.
18075823 Secretory leucoprotease inhibitor (SLPI) is a prominent innate immune protein of the respiratory tract, possessing serine protease inhibitor activity, antibacterial activity, and anti-inflammatory/immunomodulatory activity [review]
17964057 This review focuses on recent findings revealing that SLPI has many biological functions as diverse as anti-bacterial, anti-fungal, anti-viral, anti-inflammatory and immuno-modulatory functions.
17878156 secretory leukocyte protease inhibitor can inhibit interferon-gamma-induced cathepsin S production by macrophages
17371258 SLPI (secretory leucoprotease inhibitor) has important role in protecting the host from infection and injury. [secretory leucoprotease inhibitor]
16928883 Secretory levels of secretory leukocyte peptidase inhibitor (SLPI) from HIV-1 infected patients is enhanced in saliva
16776851 Newly uncovered properties of ALP to interfere with cytokine signalling and upregulation of adhesion molecules in endothelial cells are likely to contribute to the therapeutic potential of ALP in immune-complex-induced tissue injury.
16384861 Progesterone receptor transactivation of the secretory leukocyte protease inhibitor gene in Ishikawa endometrial epithelial cells involves recruitment of Kruppel-like factor 9/basic transcription element binding protein-1.
16355004 Adenoviral E1A significantly suppressed SLPI and elafin/SKALP secretion by A549 cells upon interleukin (IL)-1beta stimulation.
16336202 SLPI has antiprotease activity and antimicrobial activity against bacteria and fungi. SLPI is an important molecule in the functioning of the innate immune system.
16015083 The five genes, and three of the encoded proteins, were shown differentially expressed between a group of keratoconus patients and a reference group using different techniques
15858026 Secretory levels of secretory leukocyte peptidase inhibitor (SLPI) from HIV-1 infected patients is enhanced in saliva
15812165 Local down-regulation of SLPI in antral mucosa is a general phenomenon of Hp-related diseases.
15650263 Secretory leukocyte protease inhibitor has a role in cancer development
15492784 Lower SLPI expression is associated with cervical adenocarcinomas
15315966 SLPI localizes in part along the megakaaryocyte and platelet cytoskeleton by virtue of specific interactions with beta1 tubulin.
15248236 ALP exerts variety of blocking effects on neutrophil functions, probably due to modulation of cytoskeletal changes, that may contribute to this inhibitor's antiarthritis potential and qualify it as multifunctional regulator of inflammatory responses.
15167969 SLPI is not more highly expressed in squamous cell metaplasia as compared to areas with intact or damaged epithelium
15155685 impairs lipoteichokc acid and LPS induced proinflammatory gene expression in monocytes and macrophages in vitro. However, oxidation and elastase complex formation of SLPI diminished its anti-inflammatory effects
15039364 Antral SLPI levels were inversely correlated with inflammatory scores of antrum-predominant Helicobacter pylori gastritis.
15039315 key role in the oral mucosal defense against Candida albicans; the antimicrobial mucosal protein may serve as an indicator of previous oropharyngeal candidiasis infection among Hiv-1 infected persons
15020232 Expression of secretory leukocyte protease inhibitor is increased during mitosis in keratinocytes.
15015603 Levels of alpha1-antitrypsin and alpha1-antichymotrypsin were higher by 1.47-fold, p<0.001 and 2.27-fold, p<0.001, respectively in lung cancer cases with metastasis compared to localized tumor.
12934194 in community acquired pneumonia, both A1AT and SLPI were cleaved or complexed in infected lobes and A1AT was oxidized; conclude that mean elastase levels are increased and that mean anti-elastase capacity is decreased in pneumonic lobes
12732717 a causal role for SLPI in the malignant behavior of cancer cells, underscoring the potential malignancy-promoting activities of SPIs
12526812 SLPI has a role in wound healing and innate immunity
12392704 Secretory levels of secretory leukocyte peptidase inhibitor (SLPI) from HIV-1 infected patients is enhanced in saliva
12355371 Secretory levels of secretory leukocyte peptidase inhibitor (SLPI) from HIV-1 infected patients is enhanced in saliva
12351521 secretory leukocyte protease inhibitor transcripts were expressed in the fallopian tube and prevented the reduction of the sperm acrosome reaction by elastase
12183536 Streptococcal inhibitor of complement inhibits two additional components of the mucosal innate immune system: secretory leukocyte proteinase inhibitor and lysozyme.
12023969 mediates proliferation of human endometrial epithelial cells by positive and negative regulation of growth-associated genes
12023766 results indicate that menstrual status (pre- vs. postmenopausal) influences the production of SLPI and bactericidal activity by uterine epithelial cells
11868825 Secretory leukocyte proteinase inhibitor and elafin are resistant to degradation by MMP-8.
11817677 possible role in the defence against ascending urinary tract infections; establishing a source of SLPI in renal tubuli cells.
11759111 Secretory leukocyte protease inhibitor in punch biopsies from human colonic mucosa.
11667971 Synthesized locally at mucosal sites. Efficiently inhibit target enzymes released into interstitium. Might be important in controlling excessive neutrophil elastase release in chronic obstructive pulmonary disease and cystic fibrosis. (review)
11170993 Secretory levels of secretory leukocyte peptidase inhibitor (SLPI) from HIV-1 infected patients is enhanced in saliva
10799472 Secretory levels of secretory leukocyte peptidase inhibitor (SLPI) from HIV-1 infected patients is enhanced in saliva
10598905 Secretory levels of secretory leukocyte peptidase inhibitor (SLPI) from HIV-1 infected patients is enhanced in saliva
10548568 Secretory levels of secretory leukocyte peptidase inhibitor (SLPI) from HIV-1 infected patients is enhanced in saliva
9456660 Secretory levels of secretory leukocyte peptidase inhibitor (SLPI) from HIV-1 infected patients is enhanced in saliva

AA Sequence

MKSSGLFPFLVLLALGTLAPWAVEGSGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGI      1 - 70
KCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA             71 - 132
//

Text Mined References (111)

PMID Year Title
26555393 2016 Herpes simplex virus downregulation of secretory leukocyte protease inhibitor enhances human papillomavirus type 16 infection.
26239418 2015 Secretory leukocyte protease inhibitor inhibits expression of polymeric immunoglobulin receptor via the NF-?B signaling pathway.
26121748 2015 High IFN-? and low SLPI mark severe asthma in mice and humans.
25946035 2015 Human Basal Tear Peptidome Characterization by CID, HCD, and ETD Followed by in Silico and in Vitro Analyses for Antimicrobial Peptide Identification.
25917460 2015 The inhibitory effect of secretory leukocyte protease inhibitor (SLPI) on formation of neutrophil extracellular traps.
25851169 2015 Hypoxia down-regulates expression of secretory leukocyte protease inhibitor in bronchial epithelial cells via TGF-?1.
25559229 2015 Cervical Expression of Elafin and SLPI in Pregnancy and Their Association With Preterm Labor.
25416956 2014 A proteome-scale map of the human interactome network.
25319722 2015 Secretory leukocyte protease inhibitor is a proliferation and survival factor for pancreatic cancer cells.
25056659 2015 Human buccal epithelium acquires microbial hyporesponsiveness at birth, a role for secretory leukocyte protease inhibitor.
25041028 2014 Could targeting secretory leukocyte protease inhibitor be an effective therapeutic option to prevent infections in acute liver failure?
24764155 2015 Nodal metastasis and survival in oral cancer: Association with protein expression of SLPI, not with LCN2, TACSTD2, or THBS2.
24606882 2014 The impact of IFN-? receptor on SLPI expression in active tuberculosis: association with disease severity.
24352879 2014 A lack of secretory leukocyte protease inhibitor (SLPI) causes defects in granulocytic differentiation.
24282288 2014 Secretory leukocyte protease inhibitor modulates urethane-induced lung carcinogenesis.
24121782 2014 Enhanced expressions of lysozyme, SLPI and glycoprotein 340 in biofilm-associated chronic rhinosinusitis.
24121345 2013 Structure basis 1/2SLPI and porcine pancreas trypsin interaction.
24073410 2013 Intracellular secretory leukoprotease inhibitor modulates inositol 1,4,5-triphosphate generation and exerts an anti-inflammatory effect on neutrophils of individuals with cystic fibrosis and chronic obstructive pulmonary disease.
24023032 2014 Human epididymis protein 4 and secretory leukocyte protease inhibitor in vaginal fluid: relation to vaginal components and bacterial composition.
23996702 2014 The role of the antileukoprotease SLPI in smoking-induced human papillomavirus-independent head and neck squamous cell carcinomas.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22786767 2012 Secretory leukocyte proteinase inhibitor-competent DNA deposits are potent stimulators of plasmacytoid dendritic cells: implication for psoriasis.
22537232 2012 Secretory leukocyte protease inhibitor binds to Neisseria gonorrhoeae outer membrane opacity protein and is bactericidal.
22493362 2012 The relationship between secretory leukocyte protease inhibitor expression and Epstein-Barr virus status among patients with nasopharyngeal carcinoma.
21940052 2011 Compartmentalized secretory leukocyte protease inhibitor expression and hormone responses along the reproductive tract of postmenopausal women.
21936829 2011 SLPI and elafin: multifunctional antiproteases of the WFDC family.
21687932 2011 Secretory leukocyte protease inhibitor is associated with MMP-2 and MMP-9 to promote migration and invasion in SNU638 gastric cancer cells.
21676452 2011 Paracrine SLPI secretion upregulates MMP-9 transcription and secretion in ovarian cancer cells.
21641406 2011 Secretory leukocyte protease inhibitor (SLPI) expression and tumor invasion in oral squamous cell carcinoma.
21503571 2011 The level of secretory leukocyte protease inhibitor is decreased in metastatic head and neck squamous cell carcinoma.
21377455 2011 The alarm secretory leukocyte protease inhibitor increases with progressive metabolic dysfunction.
21335488 2011 Secretory leukocyte protease inhibitor plays an important role in the regulation of allergic asthma in mice.
21077989 2011 Secretory leukocyte protease inhibitor inhibits neutrophil apoptosis.
20551380 2010 Proteomics characterization of extracellular space components in the human aorta.
20378727 2010 17Beta-estradiol inhibits IL-8 in cystic fibrosis by up-regulating secretory leucoprotease inhibitor.
20068074 2010 Secretory leukocyte protease inhibitor antagonizes paclitaxel in ovarian cancer cells.
20047904 2010 Beneficial effects of secretory leukocyte protease inhibitor after spinal cord injury.
19900269 2009 Insights in to the pathogenesis of axial spondyloarthropathy based on gene expression profiles.
19333378 2009 The phospholipid scramblases 1 and 4 are cellular receptors for the secretory leukocyte protease inhibitor and interact with CD4 at the plasma membrane.
19271144 2009 Overexpression of histamine H(1)-receptor by human amniotic epithelial cells in chorioamnionitis correlates with augmented production of secretory leukocyte protease inhibitor.
19254589 2009 Alteration of secretory leukocyte protease inhibitor in human myometrium during labor.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19154415 2009 Overexpression of protease inhibitor-dead secretory leukocyte protease inhibitor causes more aggressive ovarian cancer in vitro and in vivo.
19095674 2009 Expression of secretory leukocyte protease inhibitor and elafin in human fallopian tube and in an in-vitro model of Chlamydia trachomatis infection.
19039956 2008 Chlamydia trachomatis and Chlamydophila abortus induce the expression of secretory leukocyte protease inhibitor in cells of the human female reproductive tract.
18976018 2008 Expression of the serine protease kallikrein 7 and its inhibitor antileukoprotease is decreased in prostate cancer.
18953959 2008 [Effects of secretory leukocyte protease inhibitor on expression of inflammation mediators in normal human bronchial epithelial cells induced by cigarette smoke extract].
18714013 2008 The major bactericidal activity of human seminal plasma is zinc-dependent and derived from fragmentation of the semenogelins.
18688858 2008 Overexpression of a secretory leukocyte protease inhibitor in human gastric cancer.
18667508 2008 Herpes simplex virus downregulates secretory leukocyte protease inhibitor: a novel immune evasion mechanism.
18425362 2008 Secretory leukoprotease inhibitor inhibits cell growth through apoptotic pathway on ovarian cancer.
18421166 2008 Complex of human neutrophil elastase with 1/2SLPI.
18285402 2008 The secretory leukocyte protease inhibitor (SLPI) and the secondary granule protein lactoferrin are synthesized in myelocytes, colocalize in subcellular fractions of neutrophils, and are coreleased by activated neutrophils.
18173453 2008 Expression of secretory leukocyte proteinase inhibitor in the submandibular glands of AIDS patients.
18075823 2007 Innate host defense functions of secretory leucoprotease inhibitor.
17964057 2008 Multifaceted roles of human elafin and secretory leukocyte proteinase inhibitor (SLPI), two serine protease inhibitors of the chelonianin family.
17878156 2007 Secretory leucocyte protease inhibitor inhibits interferon-gamma-induced cathepsin S expression.
17371258 2007 The role of secretory leucoprotease inhibitor in the resolution of inflammatory responses.
16776851 2006 Modulation of granulocyte-endothelium interactions by antileukoproteinase: inhibition of anti-type II collagen antibody-induced leukocyte attachment to the synovial endothelium.
16384861 2006 Progesterone receptor transactivation of the secretory leukocyte protease inhibitor gene in Ishikawa endometrial epithelial cells involves recruitment of Krüppel-like factor 9/basic transcription element binding protein-1.
16355004 Adenoviral E1A suppresses secretory leukoprotease inhibitor and elafin secretion in human alveolar epithelial cells and bronchial epithelial cells.
16336202 2006 SLPI and elafin: one glove, many fingers.
16015083 2005 Altered expression of CLC, DSG3, EMP3, S100A2, and SLPI in corneal epithelium from keratoconus patients.
15812165 2004 Down-regulation of secretory leukocyte protease inhibitor expression in gastric mucosa is a general phenomenon in Helicobacter pylori-related gastroduodenal diseases.
15650263 2004 Secretory leukocyte protease inhibitor in cancer development.
15492784 2004 Expression of human kallikrein 7 (hK7/SCCE) and its inhibitor antileukoprotease (ALP/SLPI) in uterine endocervical glands and in cervical adenocarcinomas.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15315966 2004 Interactions between the megakaryocyte/platelet-specific beta1 tubulin and the secretory leukocyte protease inhibitor SLPI suggest a role for regulated proteolysis in platelet functions.
15248236 2004 Antileukoproteinase: modulation of neutrophil function and therapeutic effects on anti-type II collagen antibody-induced arthritis.
15167969 2004 Human neutrophil defensins and secretory leukocyte proteinase inhibitor in squamous metaplastic epithelium of bronchial airways.
15155685 2004 Secretory leucoprotease inhibitor impairs Toll-like receptor 2- and 4-mediated responses in monocytic cells.
15039364 2004 Helicobacter pylori-mediated gastritis induces local downregulation of secretory leukocyte protease inhibitor in the antrum.
15039315 2004 Salivary secretory leukocyte protease inhibitor and oral candidiasis in human immunodeficiency virus type 1-infected persons.
15020232 2004 Mitosis increases levels of secretory leukocyte protease inhibitor in keratinocytes.
15015603 Increased plasma levels of serine proteinase inhibitors in lung cancer patients.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12934194 2003 Local impairment of anti-neutrophil elastase capacity in community-acquired pneumonia.
12874244 2003 Murine macrophages produce secretory leukocyte protease inhibitor during clearance of apoptotic cells: implications for resolution of the inflammatory response.
12819058 2003 Regulation of pulmonary and systemic bacterial lipopolysaccharide responses in transgenic mice expressing human elafin.
12759437 2003 Wound healing and expression of antimicrobial peptides/polypeptides in human keratinocytes, a consequence of common growth factors.
12732717 2003 Secretory leukocyte protease inhibitor promotes the tumorigenic and metastatic potential of cancer cells.
12526812 2002 Conversion of proepithelin to epithelins: roles of SLPI and elastase in host defense and wound repair.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12355371 2002 Salivary secretory leukocyte protease inhibitor is associated with reduced transmission of human immunodeficiency virus type 1 through breast milk.
12351521 2002 The expression of secretory leukocyte protease inhibitor (SLPI) in the fallopian tube: SLPI protects the acrosome reaction of sperm from inhibitory effects of elastase.
12206714 2002 A locus on human chromosome 20 contains several genes expressing protease inhibitor domains with homology to whey acidic protein.
12183536 2002 Streptococcal inhibitor of complement inhibits two additional components of the mucosal innate immune system: secretory leukocyte proteinase inhibitor and lysozyme.
12023969 2002 Secretory leukocyte protease inhibitor mediates proliferation of human endometrial epithelial cells by positive and negative regulation of growth-associated genes.
11912282 2002 Regulation of natural antibiotic expression by inflammatory mediators and mimics of infection in human endometrial epithelial cells.
11868825 2002 Secretory leukocyte proteinase inhibitor and elafin are resistant to degradation by MMP-8.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11667971 2000 The role of secretory leukocyte proteinase inhibitor and elafin (elastase-specific inhibitor/skin-derived antileukoprotease) as alarm antiproteinases in inflammatory lung disease.
11435427 2001 Cathepsin B, L, and S cleave and inactivate secretory leucoprotease inhibitor.
10869562 2000 Identification of a novel secretory leukocyte protease inhibitor-binding protein involved in membrane phospholipid movement.
10833481 2000 Constitutive and regulated secretion of secretory leukocyte proteinase inhibitor by human intestinal epithelial cells.
10704052 1999 Production of secretory leucocyte protease inhibitor (SLPI) in human pancreatic beta-cells.
10702419 2000 Anti-inflammatory effects of mutant forms of secretory leukocyte protease inhibitor.
10355635 1999 Identification of SLPI (secretory leukocyte protease inhibitor) in human mast cells using immunohistochemistry and in situ hybridisation.
9843921 1998 Structure of the murine secretory leukoprotease inhibitor (Slpi) gene and chromosomal localization of the human and murine SLPI genes.
8573092 1996 Inhibition of human pancreatic proteinases by mucus proteinase inhibitor, eglin c and aprotinin.
7539415 Secretory leucocyte protease inhibitor in the male genital tract: PSA-induced proteolytic processing in human semen and tissue localization.
7515550 1994 Localisation of secretory leucocyte proteinase inhibitor mRNA in nasal mucosa.
3640338 1986 Isolation and sequence of a human gene encoding a potent inhibitor of leukocyte proteases.
3533531 1986 Molecular cloning and expression of cDNA for human antileukoprotease from cervix uterus.
3485543 1986 The acid-stable proteinase inhibitor of human mucous secretions (HUSI-I, antileukoprotease). Complete amino acid sequence as revealed by protein and cDNA sequencing and structural homology to whey proteins and Red Sea turtle proteinase inhibitor.
3462719 1986 Isolation, properties, and complete amino acid sequence of human secretory leukocyte protease inhibitor, a potent inhibitor of leukocyte elastase.
3366116 1988 The 2.5 A X-ray crystal structure of the acid-stable proteinase inhibitor from human mucous secretions analysed in its complex with bovine alpha-chymotrypsin.
3060147 1988 Human mucus proteinase inhibitor (human MPI). Human seminal inhibitor I (HUSI-I), antileukoprotease (ALP), secretory leukocyte protease inhibitor (SLPI).
2110563 1990 Location of the protease-inhibitory region of secretory leukocyte protease inhibitor.
2039600 1991 Purification and characterization of elastase-specific inhibitor. Sequence homology with mucus proteinase inhibitor.
1674946 1991 Expression of the secretory leukoprotease inhibitor gene in epithelial cells.