Property Summary

NCBI Gene PubMed Count 24
PubMed Score 148.18
PubTator Score 12.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Astrocytoma, Pilocytic -1.200 2.6e-02
ependymoma -1.500 4.1e-05
lung cancer -1.200 8.1e-03
medulloblastoma -1.500 4.6e-04
non diabetic and post-ischemic heart fai... 2.000 1.9e-02
primitive neuroectodermal tumor -1.800 8.8e-03
subependymal giant cell astrocytoma 5.366 1.0e-02

Gene RIF (16)

AA Sequence

MGINTRELFLNFTIVLITVILMWLLVRSYQY                                             1 - 31
//

Text Mined References (26)

PMID Year Title