Property Summary

NCBI Gene PubMed Count 13
PubMed Score 8.90
PubTator Score 5.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
group 3 medulloblastoma 1.800 9.9e-03
non diabetic and post-ischemic heart fai... 1.400 2.5e-03
atypical teratoid / rhabdoid tumor 1.500 4.0e-02
Atopic dermatitis -1.100 1.7e-03
non-small cell lung cancer 1.167 4.1e-03
intraductal papillary-mucinous adenoma (... 2.900 4.8e-03
active Crohn's disease 3.172 5.8e-03
fibroadenoma 1.200 4.8e-02
interstitial cystitis -4.800 8.9e-06
cystic fibrosis -1.300 9.7e-04
psoriasis -1.400 4.2e-19
lung carcinoma 1.300 2.4e-02
spina bifida -1.789 4.4e-02
ovarian cancer -1.900 5.8e-05

Gene RIF (2)

PMID Text
23946138 SLITRK6 gene nonsense mutation is associated with progressive auditory neuropathy in humans.
23543054 SLITRK6 plays a crucial role in the development of normal hearing as well as vision in humans and in mice and that its disruption leads to a syndrome characterized by severe myopia and deafness.

AA Sequence

MKLWIHLFYSSLLACISLHSQTPVLSSRGSCDSLCNCEEKDGTMLINCEAKGIKMVSEISVPPSRPFQLS      1 - 70
LLNNGLTMLHTNDFSGLTNAISIHLGFNNIADIEIGAFNGLGLLKQLHINHNSLEILKEDTFHGLENLEF     71 - 140
LQADNNFITVIEPSAFSKLNRLKVLILNDNAIESLPPNIFRFVPLTHLDLRGNQLQTLPYVGFLEHIGRI    141 - 210
LDLQLEDNKWACNCDLLQLKTWLENMPPQSIIGDVVCNSPPFFKGSILSRLKKESICPTPPVYEEHEDPS    211 - 280
GSLHLAATSSINDSRMSTKTTSILKLPTKAPGLIPYITKPSTQLPGPYCPIPCNCKVLSPSGLLIHCQER    281 - 350
NIESLSDLRPPPQNPRKLILAGNIIHSLMKSDLVEYFTLEMLHLGNNRIEVLEEGSFMNLTRLQKLYLNG    351 - 420
NHLTKLSKGMFLGLHNLEYLYLEYNAIKEILPGTFNPMPKLKVLYLNNNLLQVLPPHIFSGVPLTKVNLK    421 - 490
TNQFTHLPVSNILDDLDLLTQIDLEDNPWDCSCDLVGLQQWIQKLSKNTVTDDILCTSPGHLDKKELKAL    491 - 560
NSEILCPGLVNNPSMPTQTSYLMVTTPATTTNTADTILRSLTDAVPLSVLILGLLIMFITIVFCAAGIVV    561 - 630
LVLHRRRRYKKKQVDEQMRDNSPVHLQYSMYGHKTTHHTTERPSASLYEQHMVSPMVHVYRSPSFGPKHL    631 - 700
EEEEERNEKEGSDAKHLQRSLLEQENHSPLTGSNMKYKTTNQSTEFLSFQDASSLYRNILEKERELQQLG    701 - 770
ITEYLRKNIAQLQPDMEAHYPGAHEELKLMETLMYSRPRKVLVEQTKNEYFELKANLHAEPDYLEVLEQQ    771 - 840
T//

Text Mined References (13)

PMID Year Title
23946138 2014 A homozygous SLITRK6 nonsense mutation is associated with progressive auditory neuropathy in humans.
23543054 2013 SLITRK6 mutations cause myopia and deafness in humans and mice.
23326512 2013 Genome-wide association study of irritable vs. elated mania suggests genetic differences between clinical subtypes of bipolar disorder.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14557068 2003 Human SLITRK family genes: genomic organization and expression profiling in normal brain and brain tumor tissue.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.